Gene Card
Gene overview
cDNA / CDS / Protein Sequences
411 bp · LXL04_004403|LXL04_004403|OH1004|cDNA
ATGGCTCGTACTAAGCAGACGGCAAGGAAATCCACCGGAGGAAAGGCTCCGAGGAAGCAATTGGCCACTAAGGCGGCAAGGAAGTCAGCTCCGGCTACCGGCGGAGTGAAGAAGCCACATAGATTTAGGCCTGGAACAGTGGCACTGAGAGAGATTAGGAAATACCAGAAGAGCACTGAGCTTTTGATCCGGAAACTTCCGTTCCAGAGGCTTGTGAGGGAAATCGCTCAAGATTTCAAGACCGATCTGCGATTCCAGAG...
411 bp · LXL04_004403|LXL04_004403|OH1004|CDS
ATGGCTCGTACTAAGCAGACGGCAAGGAAATCCACCGGAGGAAAGGCTCCGAGGAAGCAATTGGCCACTAAGGCGGCAAGGAAGTCAGCTCCGGCTACCGGCGGAGTGAAGAAGCCACATAGATTTAGGCCTGGAACAGTGGCACTGAGAGAGATTAGGAAATACCAGAAGAGCACTGAGCTTTTGATCCGGAAACTTCCGTTCCAGAGGCTTGTGAGGGAAATCGCTCAAGATTTCAAGACCGATCTGCGATTCCAGAG...
Protein
Download Protein FASTA136 aa · LXL04_004403|LXL04_004403|OH1004|PROTEIN
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_004403 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_004403 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:134745739-134746149 (+) | |||||||||
| Description | Similar to B34: Histone H3.2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. Rice
| |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0031507 heterochromatin formation Biological Process GO:0000786 nucleosome Cellular Component GO:0005634 nucleus Cellular Component GO:0003677 DNA binding Molecular Function GO:0030527 structural constituent of chromatin Molecular Function GO:0031492 nucleosomal DNA binding Molecular Function GO:0046982 protein heterodimerization activity Molecular Function | |||||||||
| KEGG gene cross-reference | dosa:Os01g0866200 dosa:Os04g0419600 dosa:Os05g0438700 dosa:Os06g0160100 dosa:Os11g0155900 nta:107759185 nta:107759464 nta:107763111 nta:107769564 nta:107794615 nta:107798424 nta:107816172 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00125.31Histone44-131 aaPF15511.13CENP-T_C69-130 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_004403 | PF00125.31 | Histone | 44 | 131 | 2.2e-38 | 131.2 |
| LXL04_004403 | PF15511.13 | CENP-T_C | 69 | 130 | 9.2e-06 | 26.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.