LXL04_004396 | RubberDandelionOmics

Gene overview

LXL04_004396

Reference: OH-1004 Chr: Chr01 Coordinates: 134627433-134629563 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · LXL04_004396|LXL04_004396|OH1004|cDNA

ATGGCTCAACAGCCTCCTCAGATCGCCATTATAGGTGCCGGAATCTTCGTCAAATCTCAATACCTACCCAGGCTCGCCGAGATCTCGGACCTCGTTATTCTCAAAGCTATATGGAGCCGCTCCGAGAAATCGTCAACGGAAGCTGCTGACATTGCTCGGAAGACATTTCCTAATGTGGAGTGTAAGTGGGGAGACGATGGTCTTGATGAAATTATTCGAGATTCGAGCATTGTTGGGGTGGTTGTTGCTCTTGCTGGCCA...

CDS

Download CDS FASTA

1083 bp · LXL04_004396|LXL04_004396|OH1004|CDS

ATGGCTCAACAGCCTCCTCAGATCGCCATTATAGGTGCCGGAATCTTCGTCAAATCTCAATACCTACCCAGGCTCGCCGAGATCTCGGACCTCGTTATTCTCAAAGCTATATGGAGCCGCTCCGAGAAATCGTCAACGGAAGCTGCTGACATTGCTCGGAAGACATTTCCTAATGTGGAGTGTAAGTGGGGAGACGATGGTCTTGATGAAATTATTCGAGATTCGAGCATTGTTGGGGTGGTTGTTGCTCTTGCTGGCCA...

Protein

Download Protein FASTA

360 aa · LXL04_004396|LXL04_004396|OH1004|PROTEIN

MAQQPPQIAIIGAGIFVKSQYLPRLAEISDLVILKAIWSRSEKSSTEAADIARKTFPNVECKWGDDGLDEIIRDSSIVGVVVALAGQIQVDMSLKLLKAGKHVLQEKPAASSITEVETALSSYNSLHSNSCTQKLWAVAENYRFEPAFVESRKLVSEIGDTMSVQVIIEGSMNSSNPYFSSSWRRNFTGGFILDMGVHYIAGLRMLVGCEVASVSAMTSHGDINLPPPDTISSLFQLENGCSGVFVMLVSSKSPKIVWRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004396`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_004396`
Location	Chr01:134627433-134629563 (+)
Description	Similar to YMR315W: Uncharacterized protein YMR315W (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004396` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006061 sorbitol biosynthetic process Biological Process GO:0006740 NADPH regeneration Biological Process GO:0017000 antibiotic biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0016651 oxidoreductase activity, acting on NAD(P)H Molecular Function GO:0019210 kinase inhibitor activity Molecular Function GO:0047061 glucose-fructose oxidoreductase activity Molecular Function
KEGG gene cross-reference	ag:AAA27690 bsu:BSU33530 sce:YMR315W zmo:ZMO0689 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.820

Rank 1 · LXL04_004396 · OH-1004

Nucleus0.413

Rank 2 · LXL04_004396 · OH-1004

Peroxisome0.108

Rank 3 · LXL04_004396 · OH-1004

Mitochondrion0.046

Rank 4 · LXL04_004396 · OH-1004

Endoplasmic reticulum0.040

Rank 5 · LXL04_004396 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01408.29GFO_IDH_MocA8-120 aa

PF22725.2GFO_IDH_MocA_C3157-267 aa

PF02894.23GFO_IDH_MocA_C157-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004396	`PF01408.29`	GFO_IDH_MocA	8	120	9.3e-14	52.9
LXL04_004396	`PF22725.2`	GFO_IDH_MocA_C3	157	267	1.2e-12	48.6
LXL04_004396	`PF02894.23`	GFO_IDH_MocA_C	157	347	1.8e-08	35.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card