LXL04_004380 | RubberDandelionOmics

Gene overview

LXL04_004380

Reference: OH-1004 Chr: Chr01 Coordinates: 133995237-133999431 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1554 bp · LXL04_004380|LXL04_004380|OH1004|cDNA

ATGCTTCCAGGAGTTAATGGTGTGATTGTCGGGTTTATTACAACCGTGATTTATGTGATTAAAGGGTCGGAAGCTGTCTCCAATGCGGGTTTACCTCCGAACTGGGGTTTAGCTACAGTAAACCGGTCTAGTTTTCCTAATGATTTCATTTTTGGTTCTGCATCTTCTTCTTTTCAGAACGAGGGTGGAGCAAATGAAGATGGTAGAGCTGCAAGTATATGGGATATTTTTACTCGAAGACATTCcgAGAAGATCGCTGA...

CDS

Download CDS FASTA

1554 bp · LXL04_004380|LXL04_004380|OH1004|CDS

ATGCTTCCAGGAGTTAATGGTGTGATTGTCGGGTTTATTACAACCGTGATTTATGTGATTAAAGGGTCGGAAGCTGTCTCCAATGCGGGTTTACCTCCGAACTGGGGTTTAGCTACAGTAAACCGGTCTAGTTTTCCTAATGATTTCATTTTTGGTTCTGCATCTTCTTCTTTTCAGAACGAGGGTGGAGCAAATGAAGATGGTAGAGCTGCAAGTATATGGGATATTTTTACTCGAAGACATTCCGAGAAGATCGCTGA...

Protein

Download Protein FASTA

517 aa · LXL04_004380|LXL04_004380|OH1004|PROTEIN

MLPGVNGVIVGFITTVIYVIKGSEAVSNAGLPPNWGLATVNRSSFPNDFIFGSASSSFQNEGGANEDGRAASIWDIFTRRHSEKIADRSNGNMATDSYHRYKEDVKMVRQMGMDAYSFSISWSRVIPHGKISSGVNEHGIAYYNNLINELRSNDIEPFVTLFHFDLPQALEDEYGGFLSSRVVNDFRDFAELCFRRFGDRVKFWITMNEPWSYSVGGYEKGNFAPGRCSDAVGKCPTGDSGIEPYIVTHNMLLAHAAATK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004380`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004380

Location Chr01:133995237-133999431 (+)

Description Similar to BGLU24: Beta-glucosidase 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0320200`	Beta-glucosidase 24.	No verified direct reference in this release
`UniProt: B8AVF0`	Hydrolyzes p-nitrophenyl beta-D-glucoside, p-nitrophenyl beta-D-galactoside, p-nitrophenyl beta-D-xyloside, p-nitrophenyl beta-D-fucoside, p-nitrophenyl beta-L-arabinoside, cello-oligosaccharides and laminaribiose.	No verified direct reference in this release
`Os04g0474800`	Hydrolyzes p-nitrophenyl beta-D-glucoside, p-nitrophenyl beta-D-galactoside, p-nitrophenyl beta-D-xyloside, p-nitrophenyl beta-D-fucoside, p-nitrophenyl beta-L-arabinoside, cello-oligosaccharides and laminaribiose.	No verified direct reference in this release
`Os04g0474900`	Beta-glucosidase 13.	No verified direct reference in this release
`Os04g0474500`	Beta-glucosidase 10.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004380 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004338 glucan exo-1,3-beta-glucosidase activity Molecular Function

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0033907 beta-D-fucosidase activity Molecular Function

GO:0047701 beta-L-arabinosidase activity Molecular Function

GO:0080083 beta-gentiobiose beta-glucosidase activity Molecular Function

KEGG gene cross-reference

dosa:Os04g0474500

dosa:Os04g0474800

dosa:Os04g0474900

dosa:Os06g0320200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.286

Rank 1 · LXL04_004380 · OH-1004

Endoplasmic reticulum0.137

Rank 2 · LXL04_004380 · OH-1004

Plastid0.126

Rank 3 · LXL04_004380 · OH-1004

Extracellular0.087

Rank 4 · LXL04_004380 · OH-1004

Cell membrane0.085

Rank 5 · LXL04_004380 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232.25Glyco_hydro_143-513 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004380	`PF00232.25`	Glyco_hydro_1	43	513	1.1e-153	512.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5Z9Z0`	Oryza sativa subsp. japonica	Beta-glucosidase 24	57.652%	Swiss-Prot	strong database homology
`B8AVF0`	Oryza sativa subsp. indica	Beta-glucosidase 12	57.661%	Swiss-Prot	strong database homology
`Q7XKV4`	Oryza sativa subsp. japonica	Beta-glucosidase 12	57.661%	Swiss-Prot	strong database homology
`Q7XKV2`	Oryza sativa subsp. japonica	Beta-glucosidase 13	56.823%	Swiss-Prot	strong database homology
`Q7F9K4`	Oryza sativa subsp. japonica	Beta-glucosidase 10	52.233%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card