LXL04_004309 | RubberDandelionOmics

Gene overview

LXL04_004309

Reference: OH-1004 Chr: Chr01 Coordinates: 132011845-132012459 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

615 bp · LXL04_004309|LXL04_004309|OH1004|cDNA

ATGGCACGATGTGCGAGCTTTGCCACTTTTATTGCTTGTTTATTTTTGACATCTCTTTTGCTGGGTGTCGTCGTTCTTTTTCCAGTCATGATAGCTCTATTCGCATCGCCCTCTAGCCCCTCTTTTGCAGTTAATCTATTCCATAATCAAACCTTGAACATGACCACAAACTTGACTATCCACTTCGATCTCAAGCTAAAAAACGAAAACAAAGCAATAGGTCTTCATTACCCGGATCAGATCAATATCACGTTTTCCTA...

CDS

Download CDS FASTA

615 bp · LXL04_004309|LXL04_004309|OH1004|CDS

ATGGCACGATGTGCGAGCTTTGCCACTTTTATTGCTTGTTTATTTTTGACATCTCTTTTGCTGGGTGTCGTCGTTCTTTTTCCAGTCATGATAGCTCTATTCGCATCGCCCTCTAGCCCCTCTTTTGCAGTTAATCTATTCCATAATCAAACCTTGAACATGACCACAAACTTGACTATCCACTTCGATCTCAAGCTAAAAAACGAAAACAAAGCAATAGGTCTTCATTACCCGGATCAGATCAATATCACGTTTTCCTA...

Protein

Download Protein FASTA

204 aa · LXL04_004309|LXL04_004309|OH1004|PROTEIN

MARCASFATFIACLFLTSLLLGVVVLFPVMIALFASPSSPSFAVNLFHNQTLNMTTNLTIHFDLKLKNENKAIGLHYPDQINITFSYFPNVSSLVILADYKLDSFYQGNGKTKHVRDVVEAVGFPRVLEGTDMMVFRVDLMGSFRYKKVGTKRHKVELGCLVAVDSITNNKMQRGFIRMVKPGLDSKLKRKPTPHYGGGVGRRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004309`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004309

Location Chr01:132011845-132012459 (-)

Description Similar to NDR1: Protein NDR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20600`	Involved in disease resistance.	NDR1, a locus of Arabidopsis thaliana that is required for disease resistance to both a bacterial and a fungal pathogen.1995 · DOI: 10.1073/pnas.92.14.6597 The role of NDR1 in avirulence gene-directed signaling and control of programmed cell death in Arabidopsis.2001 · PMID: 11706189 Overexpression of the plasma membrane-localized NDR1 protein results in enhanced bacterial disease resistance in Arabidopsis thaliana.2004 · DOI: 10.1111/j.1365-313x.2004.02203.x Early responses in the Arabidopsis-Verticillium longisporum pathosystem are dependent on NDR1, JA- and ET-associated signals via cytosolic NPR1 and RFO1.2006 · DOI: 10.1094/mpmi-19-0958 NDR1 interaction with RIN4 mediates the differential activation of multiple disease resistance pathways in Arabidopsis.2006 · DOI: 10.1105/tpc.106.044693

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004309 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT3G20600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.625

Rank 1 · LXL04_004309 · OH-1004

Endoplasmic reticulum0.168

Rank 2 · LXL04_004309 · OH-1004

Cytoplasm0.117

Rank 3 · LXL04_004309 · OH-1004

Lysosome / Vacuole0.094

Rank 4 · LXL04_004309 · OH-1004

Nucleus0.082

Rank 5 · LXL04_004309 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48915`	Arabidopsis thaliana	Protein NDR1	30.890%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card