LXL04_004226 | RubberDandelionOmics

Gene overview

LXL04_004226

Reference: OH-1004 Chr: Chr01 Coordinates: 130170187-130172022 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · LXL04_004226|LXL04_004226|OH1004|cDNA

ATGTCAACTACTCCCAACAGCTATCCATCTCTCTGTTCTTCTCCGCCATTACCACGAACAATAAACTCACTAACGACACAACCGTTATCTTTCGTCACATCTCAGTTCAAGCAAACGTTGCTAAAAAAGCCCAAAACCCTAAGTTTTTCAATCAGGTTAGGGAATTCGAGTTTGGAGAAACAATCGATTTTGATAGTTAGAGCGTCGGCGGAAAATGGAGCAGCAGAAGAAGAGGAAAAGTACGAAGAATATGAGGTAGA...

CDS

Download CDS FASTA

993 bp · LXL04_004226|LXL04_004226|OH1004|CDS

ATGTCAACTACTCCCAACAGCTATCCATCTCTCTGTTCTTCTCCGCCATTACCACGAACAATAAACTCACTAACGACACAACCGTTATCTTTCGTCACATCTCAGTTCAAGCAAACGTTGCTAAAAAAGCCCAAAACCCTAAGTTTTTCAATCAGGTTAGGGAATTCGAGTTTGGAGAAACAATCGATTTTGATAGTTAGAGCGTCGGCGGAAAATGGAGCAGCAGAAGAAGAGGAAAAGTACGAAGAATATGAGGTAGA...

Protein

Download Protein FASTA

330 aa · LXL04_004226|LXL04_004226|OH1004|PROTEIN

MSTTPNSYPSLCSSPPLPRTINSLTTQPLSFVTSQFKQTLLKKPKTLSFSIRLGNSSLEKQSILIVRASAENGAAEEEEKYEEYEVELDQPYGLRFAKGRDGGTYIDAIAPGGNADKTKLFTVGDKVVATSAVFGTEMWPAAEYGRTMYTIRQRIGPLLMKMEKRYGKMDDDSKLTEKEIIRAERNSGIVSGKLREIQMQNYLRKKEQKETRTRELREGLQLYKSGKYEEALEKFESVLGSKPEINESSVASYNVACCYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004226`
TK1151 ID	TkA01G177970
OH-1004 ID	LXL04_004226
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004226

Location Chr01:130170187-130172022 (+)

Description Similar to MET1: Protein MET1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55480`	Involved in photosystem II supercomplex formation and repair, probably acting as a psbB/psbC chaperone on the stromal side of the membrane.	No verified direct reference in this release
`At1g02910`	Chaperone required for efficient photosystem II (PSII) assembly.	LOW PSII ACCUMULATION1 is involved in efficient assembly of photosystem II in Arabidopsis thaliana.2006 · DOI: 10.1105/tpc.105.037689
`At3g01510`	Starch granule-associated phosphoglucan phosphatase involved in the control of starch accumulation.	A putative phosphatase, LSF1, is required for normal starch turnover in Arabidopsis leaves.2010 · DOI: 10.1104/pp.109.148981

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004226 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005983 starch catabolic process Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0010206 photosystem II repair Biological Process

GO:0010207 photosystem II assembly Biological Process

GO:0010270 photosystem II oxygen evolving complex assembly Biological Process

GO:0015979 photosynthesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009523 photosystem II Cellular Component

KEGG gene cross-reference

ath:AT1G02910

ath:AT1G55480

ath:AT3G01510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.983

Rank 1 · LXL04_004226 · OH-1004

Mitochondrion0.023

Rank 2 · LXL04_004226 · OH-1004

Nucleus0.016

Rank 3 · LXL04_004226 · OH-1004

Cytoplasm0.012

Rank 4 · LXL04_004226 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_004226 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BS2`	Arabidopsis thaliana	Protein MET1, chloroplastic	77.273%	Swiss-Prot	strong database homology
`Q9SRY4`	Arabidopsis thaliana	Protein LOW PSII ACCUMULATION 1, chloroplastic	34.884%	Swiss-Prot	weak database homology
`F4J117`	Arabidopsis thaliana	Phosphoglucan phosphatase LSF1, chloroplastic	30.952%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card