LXL04_004138 | RubberDandelionOmics

Gene overview

LXL04_004138

Reference: OH-1004 Chr: Chr01 Coordinates: 126277113-126279024 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1443 bp · LXL04_004138|LXL04_004138|OH1004|cDNA

ATGAAAATGAACACATGGACGACATTCTGGAACTCAAAGAGTAGTTTTGATTGTGCTAATAAAGTTATAACTGAGAAAGTTCACGGAGTACAAAATACGGTGAAATGGGTCGATAGTTGCAAAGATTGTTTGGAAAATGGTACAAAGCCATGCAAGTGCATCGACAGTAATCATGGTAACAACGAGGTGCAGTTCGAGATTAAAAACGACATAAATGACCGGGAGGCGCATTCAACAAATGCGAATAGTTCTTTCCTTCA...

CDS

Download CDS FASTA

1443 bp · LXL04_004138|LXL04_004138|OH1004|CDS

ATGAAAATGAACACATGGACGACATTCTGGAACTCAAAGAGTAGTTTTGATTGTGCTAATAAAGTTATAACTGAGAAAGTTCACGGAGTACAAAATACGGTGAAATGGGTCGATAGTTGCAAAGATTGTTTGGAAAATGGTACAAAGCCATGCAAGTGCATCGACAGTAATCATGGTAACAACGAGGTGCAGTTCGAGATTAAAAACGACATAAATGACCGGGAGGCGCATTCAACAAATGCGAATAGTTCTTTCCTTCA...

Protein

Download Protein FASTA

480 aa · LXL04_004138|LXL04_004138|OH1004|PROTEIN

MKMNTWTTFWNSKSSFDCANKVITEKVHGVQNTVKWVDSCKDCLENGTKPCKCIDSNHGNNEVQFEIKNDINDREAHSTNANSSFLQSSVNMIGMLIGLGQLSTSYALENGGWISSFLLITLGIACTYTSHLLGKCLENNRKSRNYTDIGHHAFGSRGRAIAATFIYLEIFMALISYTISLHDNLKMVFLGTNVHFSWAHHLSTSQVLTVFAVLVALPSLWLRDLASISFLSTSGIIMSLMIFVTVVCTAVFGGITANHT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004138`
TK1151 ID	TkA01G198280
OH-1004 ID	LXL04_004138
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004138

Location Chr01:126277113-126279024 (+)

Description Similar to AVT1H: Amino acid transporter AVT1H

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16740`	Amino acid transporter AVT1H.	No verified direct reference in this release
`At3g54830`	Amino acid transporter AVT1B.	No verified direct reference in this release
`At5g02180`	Amino acid transporter AVT1D.	No verified direct reference in this release
`At5g02170`	Amino acid transporter AVT1E.	No verified direct reference in this release
`At3g09340`	Amino acid transporter AVT1F.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004138 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0031090 organelle membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G09340

ath:AT3G54830

ath:AT5G02170

ath:AT5G02180

ath:AT5G16740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.593

Rank 1 · LXL04_004138 · OH-1004

Lysosome / Vacuole0.185

Rank 2 · LXL04_004138 · OH-1004

Cytoplasm0.143

Rank 3 · LXL04_004138 · OH-1004

Endoplasmic reticulum0.101

Rank 4 · LXL04_004138 · OH-1004

Mitochondrion0.060

Rank 5 · LXL04_004138 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490.25Aa_trans82-466 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004138	`PF01490.25`	Aa_trans	82	466	2e-60	205.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFE3`	Arabidopsis thaliana	Amino acid transporter AVT1H	58.080%	Swiss-Prot	strong database homology
`F4JE35`	Arabidopsis thaliana	Amino acid transporter AVT1B	35.264%	Swiss-Prot	moderate database homology
`Q8GYS4`	Arabidopsis thaliana	Amino acid transporter AVT1D	34.383%	Swiss-Prot	moderate database homology
`Q8LPF4`	Arabidopsis thaliana	Amino acid transporter AVT1E	36.104%	Swiss-Prot	moderate database homology
`F4IZW8`	Arabidopsis thaliana	Amino acid transporter AVT1F	34.351%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card