LXL04_004133 | RubberDandelionOmics

Gene overview

LXL04_004133

Reference: OH-1004 Chr: Chr01 Coordinates: 126137497-126139071 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · LXL04_004133|LXL04_004133|OH1004|cDNA

CAGATCTCGGGTATTAGTTGTCGATCCTCTCCCACCTCCCGGCTGTACCCATTCAACCTCACGAAATCTTCACTCCCACTCGAACTCATCTCCATCGCTAGGTTGTCTAAGCTCAGGTTCCAAGGACGACTTTTGATCAGCTCTTCGAGGAGAAAACGAGGTTGCAGAATCCGTATTACAGGTGAGTTGCTAAGCTTTTTGTCAGAGATTCCTTGTGTGCATTTGATAGTGGTGGTTGGAGGACTAGATGAGTTAATGCC...

CDS

Download CDS FASTA

315 bp · LXL04_004133|LXL04_004133|OH1004|CDS

CTGTACCCATTCAACCTCACGAAATCTTCACTCCCACTCGAACTCATCTCCATCGCTAGGTTGTCTAAGCTCAGGTTCCAAGGACGACTTTTGATCAGCTCTTCGAGGAGAAAACGAGGTTGCAGAATCCGTATTACAGGTGAGTTGCTAAGCTTTTTGTCAGAGATTCCTTGTGTGCATTTGATAGTGGTGGTTGGAGGACTAGATGAGTTAATGCCATCTCTTCCATCAGCAACTGGGGTTAAAGTTGTATCATTTTC...

Protein

Download Protein FASTA

105 aa · LXL04_004133|LXL04_004133|OH1004|PROTEIN

MYPFNLTKSSLPLELISIARLSKLRFQGRLLISSSRRKRGCRIRITGELLSFLSEIPCVHLIVVVGGLDELMPSLPSATGVKVVSFSKLITQGSSNHHPFHPPKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004133`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004133

Location Chr01:126137497-126139071 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27600`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation (Probable).	Two long-chain acyl-CoA synthetases from Arabidopsis thaliana involved in peroxisomal fatty acid beta-oxidation.2002 · DOI: 10.1046/j.1365-313x.2002.01405.x Peroxisomal Acyl-CoA synthetase activity is essential for seedling development in Arabidopsis thaliana.2004 · DOI: 10.1105/tpc.019646 Analysis of the role of COMATOSE and peroxisomal beta-oxidation in the determination of germination potential in Arabidopsis.2006 · DOI: 10.1093/jxb/erl045

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004133 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010193 response to ozone Biological Process

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0004467 long-chain fatty acid-CoA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0102391 decanoate-CoA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT5G27600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.359

Rank 1 · LXL04_004133 · OH-1004

Cytoplasm0.353

Rank 2 · LXL04_004133 · OH-1004

Mitochondrion0.142

Rank 3 · LXL04_004133 · OH-1004

Cell membrane0.139

Rank 4 · LXL04_004133 · OH-1004

Endoplasmic reticulum0.095

Rank 5 · LXL04_004133 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LKS5`	Arabidopsis thaliana	Long chain acyl-CoA synthetase 7, peroxisomal	66.667%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card