LXL04_003963 | RubberDandelionOmics

Gene overview

LXL04_003963

Reference: OH-1004 Chr: Chr01 Coordinates: 118377063-118381404 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1371 bp · LXL04_003963|LXL04_003963|OH1004|cDNA

ATGGCTATTTTCAGTGCCAGGCTCTGCTCGTTTCCCACACAACCATCTATTATTTCAGCATCATCAACTAAAGATACAAACGGGAATTCAGTAAAATTAAGAGATGATTGGAGGCAACGATCCAAACCTATACCTCCTGGCGGCACCTACCCAGCTAAAGATCAGTGCAGTAAATGTGGGTTGTGTGATACTTACTACATTGCTCATGTGAAGAATGCCTGTGCTTTCTTGGGAGATGGGATGTCAAGAATTGAAGGGCT...

CDS

Download CDS FASTA

1371 bp · LXL04_003963|LXL04_003963|OH1004|CDS

ATGGCTATTTTCAGTGCCAGGCTCTGCTCGTTTCCCACACAACCATCTATTATTTCAGCATCATCAACTAAAGATACAAACGGGAATTCAGTAAAATTAAGAGATGATTGGAGGCAACGATCCAAACCTATACCTCCTGGCGGCACCTACCCAGCTAAAGATCAGTGCAGTAAATGTGGGTTGTGTGATACTTACTACATTGCTCATGTGAAGAATGCCTGTGCTTTCTTGGGAGATGGGATGTCAAGAATTGAAGGGCT...

Protein

Download Protein FASTA

456 aa · LXL04_003963|LXL04_003963|OH1004|PROTEIN

MAIFSARLCSFPTQPSIISASSTKDTNGNSVKLRDDWRQRSKPIPPGGTYPAKDQCSKCGLCDTYYIAHVKNACAFLGDGMSRIEGLEKVVHGRGRNVDSLDETYFGVHEELLYARKTNPVEGAQWTGIVTTIAIEMLKSGMVEAVICVQSDPEDRLSPRPVLARTPEEVLAARGVKPTLSPNLNTLALVEAAGVKRLLFCGVGCQVQALRSVEKHLNLEKLYVLGTNCVDNGTRDGLDKFLRAASTDPDTVLHYEFMQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003963`
TK1151 ID	TkA01G225500
OH-1004 ID	LXL04_003963
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003963

Location Chr01:118377063-118381404 (+)

Description Similar to HCAR: 7-hydroxymethyl chlorophyll a reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04620`	Probable iron-sulfur flavoprotein that converts 7-hydroxymethyl chlorophyll a to chlorophyll a using ferredoxin as a reducing equivalent.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0320100`	Probable iron-sulfur flavoprotein that converts 7-hydroxymethyl chlorophyll a to chlorophyll a using ferredoxin as a reducing equivalent.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003963 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015994 chlorophyll metabolic process Biological Process

GO:0033354 chlorophyll cycle Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016151 nickel cation binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0050454 coenzyme F420 hydrogenase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

GO:0052592 oxidoreductase activity, acting on CH or CH2 groups, with an iron-sulfur protein as acceptor Molecular Function

GO:0090415 7-hydroxymethyl chlorophyll a reductase activity Molecular Function

KEGG gene cross-reference

ana:all1601

ath:AT1G04620

dosa:Os04g0320100

mba:Mbar_A0449

osa:4335472

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · LXL04_003963 · OH-1004

Mitochondrion0.040

Rank 2 · LXL04_003963 · OH-1004

Cytoplasm0.024

Rank 3 · LXL04_003963 · OH-1004

Nucleus0.023

Rank 4 · LXL04_003963 · OH-1004

Peroxisome0.017

Rank 5 · LXL04_003963 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04422.19FrhB_FdhB_N113-187 aa

PF04432.19FrhB_FdhB_C196-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003963	`PF04422.19`	FrhB_FdhB_N	113	187	3.7e-26	91.8
LXL04_003963	`PF04432.19`	FrhB_FdhB_C	196	343	2e-27	96.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GS60`	Arabidopsis thaliana	7-hydroxymethyl chlorophyll a reductase, chloroplastic	81.345%	Swiss-Prot	strong database homology
`Q7XTG7`	Oryza sativa subsp. japonica	7-hydroxymethyl chlorophyll a reductase, chloroplastic	79.814%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card