LXL04_003936 | RubberDandelionOmics

Gene overview

LXL04_003936

Reference: OH-1004 Chr: Chr01 Coordinates: 116613258-116614237 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

900 bp · LXL04_003936|LXL04_003936|OH1004|cDNA

ATGTCTTCACATTTATCAATGAAACCCTTGCCCTTTCTCTCTTTGTTCTTGCTCTTCGTCCTCCCTCTGGTTACATCGGCACCGGATAACTCAAACTTAGTTTATAAAGGATGTGCAAACCAACCTCTGCCAGATCCAAATGGCGTTTACTCGTCTGCCCTCTCTGCCATTTTCGGGACTCTAATTCAACAATCTTCAAAATCTAAGTTCTACAAGACAACAAGTGGCAGTGGACAAGCATCCGTTTCTGGCCTTTTTCA...

CDS

Download CDS FASTA

900 bp · LXL04_003936|LXL04_003936|OH1004|CDS

ATGTCTTCACATTTATCAATGAAACCCTTGCCCTTTCTCTCTTTGTTCTTGCTCTTCGTCCTCCCTCTGGTTACATCGGCACCGGATAACTCAAACTTAGTTTATAAAGGATGTGCAAACCAACCTCTGCCAGATCCAAATGGCGTTTACTCGTCTGCCCTCTCTGCCATTTTCGGGACTCTAATTCAACAATCTTCAAAATCTAAGTTCTACAAGACAACAAGTGGCAGTGGACAAGCATCCGTTTCTGGCCTTTTTCA...

Protein

Download Protein FASTA

299 aa · LXL04_003936|LXL04_003936|OH1004|PROTEIN

MSSHLSMKPLPFLSLFLLFVLPLVTSAPDNSNLVYKGCANQPLPDPNGVYSSALSAIFGTLIQQSSKSKFYKTTSGSGQASVSGLFQCRGDLSNVDCYSCVSRLPILMDKLCGKTVAARIQLLGCYMLYEVSGFSQISGMELLYKTCGKTNAGGNGFQQRRDSAFSSMESVIGSGNGGFYTTSYESMYVLGQCQGDLGTSDCGNCVKSALQRAQVECGSSISGQIYLHRCFISYNYYPNGTPKPNKPSTSYSSPSSSSSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003936`
TK1151 ID	TkA01G227170
OH-1004 ID	LXL04_003936
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.391 / OH-1004 84.950 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003936

Location Chr01:116613258-116614237 (-)

Description Similar to PDLP2: Plasmodesmata-located protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04520`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At2g33330`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At5g43980`	Modulates cell-to-cell trafficking.	The plasmodesmal protein PDLP1 localises to haustoria-associated membranes during downy mildew infection and regulates callose deposition.2014 · DOI: 10.1371/journal.ppat.1004496
`At3g04370`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At3g60720`	Modulates cell-to-cell trafficking.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003936 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009615 response to virus Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0046739 transport of virus in multicellular host Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G04520

ath:AT2G33330

ath:AT3G04370

ath:AT3G60720

ath:AT5G43980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.794

Rank 1 · LXL04_003936 · OH-1004

Extracellular0.101

Rank 2 · LXL04_003936 · OH-1004

Cytoplasm0.075

Rank 3 · LXL04_003936 · OH-1004

Endoplasmic reticulum0.074

Rank 4 · LXL04_003936 · OH-1004

Nucleus0.031

Rank 5 · LXL04_003936 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657.23Stress-antifung45-130 aa

PF01657.23Stress-antifung147-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003936	`PF01657.23`	Stress-antifung	45	130	8.8e-28	97.6
LXL04_003936	`PF01657.23`	Stress-antifung	147	235	8.8e-28	97.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NM73`	Arabidopsis thaliana	Plasmodesmata-located protein 2	60.066%	Swiss-Prot	strong database homology
`O22784`	Arabidopsis thaliana	Plasmodesmata-located protein 3	60.667%	Swiss-Prot	strong database homology
`Q8GXV7`	Arabidopsis thaliana	Plasmodesmata-located protein 1	45.862%	Swiss-Prot	moderate database homology
`Q6E263`	Arabidopsis thaliana	Plasmodesmata-located protein 4	32.292%	Swiss-Prot	moderate database homology
`Q6NKQ9`	Arabidopsis thaliana	Plasmodesmata-located protein 8	28.676%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card