Gene Card
Gene overview
cDNA / CDS / Protein Sequences
516 bp · LXL04_003852|LXL04_003852|OH1004|cDNA
ATGCCCTCAACCTCTTCCAGGTATTATCAGACTGGTTATCGGATTCATACTGAGACTGTCGTCGAGGGTCAAGTTATGCAAAAGCAAGAGTTTGTTGAGCAGAGTAGAATGGCTTTGGAGAAATACTTGAGAAAGCTAGCAGCCTATCGTTGGAGAAGGAAGAATGTGAGTTCGAACTCGTTGCTGTCTAGACTTGCTTCCAAGGTGTTTGAATTCTACGGCCCCTCTTCTCTACGTCATCTTCTCCACTACAGGCTGGG...
516 bp · LXL04_003852|LXL04_003852|OH1004|CDS
ATGCCCTCAACCTCTTCCAGGTATTATCAGACTGGTTATCGGATTCATACTGAGACTGTCGTCGAGGGTCAAGTTATGCAAAAGCAAGAGTTTGTTGAGCAGAGTAGAATGGCTTTGGAGAAATACTTGAGAAAGCTAGCAGCCTATCGTTGGAGAAGGAAGAATGTGAGTTCGAACTCGTTGCTGTCTAGACTTGCTTCCAAGGTGTTTGAATTCTACGGCCCCTCTTCTCTACGTCATCTTCTCCACTACAGGCTGGG...
Protein
Download Protein FASTA171 aa · LXL04_003852|LXL04_003852|OH1004|PROTEIN
MPSTSSRYYQTGYRIHTETVVEGQVMQKQEFVEQSRMALEKYLRKLAAYRWRRKNVSSNSLLSRLASKVFEFYGPSSLRHLLHYRLGRKISDTIGKLIHDSCQGFAGVALDLFYPFAPAWGAEVLVSRGCRFQKKRKILENVNLSGGKGDSDSTEGRDLKAELERLRDLGR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_003852 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_003852 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:109417822-109419188 (-) | |||||||||
| Description | Similar to SNX2A: Sorting nexin 2A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0032502 developmental process Biological Process GO:0045324 late endosome to vacuole transport Biological Process GO:0051604 protein maturation Biological Process GO:0090351 seedling development Biological Process GO:0005634 nucleus Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0009536 plastid Cellular Component GO:0016020 membrane Cellular Component GO:0030904 retromer complex Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT5G07120 ath:AT5G58440 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.