LXL04_003735 | RubberDandelionOmics

Gene overview

LXL04_003735

Reference: OH-1004 Chr: Chr01 Coordinates: 98319588-98324104 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

687 bp · LXL04_003735|LXL04_003735|OH1004|cDNA

ATGTCTTCTTGCAGCCTGACTCTTGGAGATGCTACAAAACAAGATGCTGTTTCGTACGGTATATACCCATCTAGGCCGGAGTCTGTGATATTCAAAGACTTCAACTTAAAAGTTCCTGCGGGGAAGACGATGGCATTGGTAGGTGGGAGTGGGTCTGGTAAATCAACGGTGATTGCATTGTTGCAGAGGTTTTATGATCCTAAAGGAGGAGATATTTTTGTAGATGGGGTGAGGATTGATAAGCTTCAACTAAAATGGCT...

CDS

Download CDS FASTA

687 bp · LXL04_003735|LXL04_003735|OH1004|CDS

ATGTCTTCTTGCAGCCTGACTCTTGGAGATGCTACAAAACAAGATGCTGTTTCGTACGGTATATACCCATCTAGGCCGGAGTCTGTGATATTCAAAGACTTCAACTTAAAAGTTCCTGCGGGGAAGACGATGGCATTGGTAGGTGGGAGTGGGTCTGGTAAATCAACGGTGATTGCATTGTTGCAGAGGTTTTATGATCCTAAAGGAGGAGATATTTTTGTAGATGGGGTGAGGATTGATAAGCTTCAACTAAAATGGCT...

Protein

Download Protein FASTA

228 aa · LXL04_003735|LXL04_003735|OH1004|PROTEIN

MSSCSLTLGDATKQDAVSYGIYPSRPESVIFKDFNLKVPAGKTMALVGGSGSGKSTVIALLQRFYDPKGGDIFVDGVRIDKLQLKWLRSQMGLVSQEPALFATSIKENILFGKEDATMDEVIEAAKASNAHNLISVLPQAYDTQIDEGFLLRVAGALITKHPLIVPYLKKTEAERRHWLSSRSRRREQPLGGVNGHQRGVNGSLLRAGGMISSYHSPPAKTDKVKILA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003735`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003735

Location Chr01:98319588-98324104 (-)

Description Similar to ABCB15: ABC transporter B family member 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28345`	ABC transporter B family member 15.	No verified direct reference in this release
`At3g28390`	ABC transporter B family member 18.	No verified direct reference in this release
`At3g28360`	ABC transporter B family member 16.	No verified direct reference in this release
`At3g28380`	ABC transporter B family member 17.	No verified direct reference in this release
`At3g28415`	ABC transporter B family member 22.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003735 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G28345

ath:AT3G28360

ath:AT3G28390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.305

Rank 1 · LXL04_003735 · OH-1004

Mitochondrion0.189

Rank 2 · LXL04_003735 · OH-1004

Peroxisome0.158

Rank 3 · LXL04_003735 · OH-1004

Nucleus0.140

Rank 4 · LXL04_003735 · OH-1004

Plastid0.140

Rank 5 · LXL04_003735 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran32-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003735	`PF00005.34`	ABC_tran	32	130	2.1e-18	68.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHD1`	Arabidopsis thaliana	ABC transporter B family member 15	77.953%	Swiss-Prot	moderate database homology
`Q9LSJ5`	Arabidopsis thaliana	ABC transporter B family member 18	63.429%	Swiss-Prot	strong database homology
`Q9LSJ8`	Arabidopsis thaliana	ABC transporter B family member 16	74.603%	Swiss-Prot	moderate database homology
`Q9LSJ6`	Arabidopsis thaliana	ABC transporter B family member 17	75.397%	Swiss-Prot	moderate database homology
`Q9LSJ2`	Arabidopsis thaliana	ABC transporter B family member 22	72.441%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card