LXL04_003713 | RubberDandelionOmics

Gene overview

LXL04_003713

Reference: OH-1004 Chr: Chr01 Coordinates: 96677096-96681586 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1134 bp · LXL04_003713|LXL04_003713|OH1004|cDNA

ATGCAGATTAAGATATGTAACGGAAAGTTATTTCAAGTAGTTGCATCCACAAAGGGCTTCTACGCCCTGGGAAAGCAGTTTTTGCAAAGCCATTCCCTGGTGGATCTTCTTCAACAGCTCAGTCAAGCTTTTGCTAACGCAGCATATGAATCCTTGATGAAAGCCTACCAAGAACATAACAAGTTTGGTAATCTTCCATATGGTTTTCGAGCAAACACCTGGTTAGTTCCTCCATCCATCCTAGATTCAGAATCAATCAA...

CDS

Download CDS FASTA

1134 bp · LXL04_003713|LXL04_003713|OH1004|CDS

ATGCAGATTAAGATATGTAACGGAAAGTTATTTCAAGTAGTTGCATCCACAAAGGGCTTCTACGCCCTGGGAAAGCAGTTTTTGCAAAGCCATTCCCTGGTGGATCTTCTTCAACAGCTCAGTCAAGCTTTTGCTAACGCAGCATATGAATCCTTGATGAAAGCCTACCAAGAACATAACAAGTTTGGTAATCTTCCATATGGTTTTCGAGCAAACACCTGGTTAGTTCCTCCATCCATCCTAGATTCAGAATCAATCAA...

Protein

Download Protein FASTA

377 aa · LXL04_003713|LXL04_003713|OH1004|PROTEIN

MQIKICNGKLFQVVASTKGFYALGKQFLQSHSLVDLLQQLSQAFANAAYESLMKAYQEHNKFGNLPYGFRANTWLVPPSILDSESINNPLPSEDPTWGGNGGGQGQNGQHDHRPWATEFAILASLPCKTEEQRVIRDRKAFLIHSLFVDVSIFKSVSTIRKVIDSGSTVHVMQQMQAQSQKPGEGLILKTPYYNRHQLFQIPHLATTCVAVNSLITLGGHKTLSSVADMLVWSYLAEHAAVLDEVLATYLATNTEVDLLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003713`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003713

Location Chr01:96677096-96681586 (-)

Description Similar to TSS: Protein TSS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28080`	Negatively regulates meristematic tissue proliferation by integrating developmental signals with carbon source availability.	No verified direct reference in this release
`At1g15290`	May act as the scaffold of a protein complex, which sequesters key factors that are required for the G2 to M transition in meristematic tissues (By similarity).	No verified direct reference in this release
`At1g01320`	May act as the scaffold of a protein complex, which sequesters key factors that are required for the G2 to M transition in meristematic tissues (By similarity).	REDUCED CHLOROPLAST COVERAGE genes from Arabidopsis thaliana help to establish the size of the chloroplast compartment.2016 · DOI: 10.1073/pnas.1515741113

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003713 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007005 mitochondrion organization Biological Process

GO:0010906 regulation of glucose metabolic process Biological Process

GO:0019750 chloroplast localization Biological Process

GO:0048312 intracellular distribution of mitochondria Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ang:An02g06530

ath:AT1G01320

ath:AT1G15290

ath:AT4G28080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.567

Rank 1 · LXL04_003713 · OH-1004

Cytoplasm0.414

Rank 2 · LXL04_003713 · OH-1004

Mitochondrion0.081

Rank 3 · LXL04_003713 · OH-1004

Cell membrane0.057

Rank 4 · LXL04_003713 · OH-1004

Endoplasmic reticulum0.046

Rank 5 · LXL04_003713 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JKH6`	Arabidopsis thaliana	Protein REDUCED CHLOROPLAST COVERAGE 2	63.636%	Swiss-Prot	weak database homology
`F4HZK4`	Arabidopsis thaliana	Protein REDUCED CHLOROPLAST COVERAGE 3	56.614%	Swiss-Prot	moderate database homology
`F4HS99`	Arabidopsis thaliana	Protein REDUCED CHLOROPLAST COVERAGE 1	56.442%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card