LXL04_003681 | RubberDandelionOmics

Gene overview

LXL04_003681

Reference: OH-1004 Chr: Chr01 Coordinates: 94211153-94213164 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · LXL04_003681|LXL04_003681|OH1004|cDNA

ATGGGACTATCTTTCACGAAGCTATTCAAGCGGTTATGTGCAAAGAAAGAGATGCGTATTCTCATGGTGGGTCTTGATGCGGCTGGTAAAACCACAATCTTGTACAAGCTCAAATTGGGGGAAATTGTCACCACTATTCCTACTATTGGATTCAACGTGGAGACTGTTGAGTATAAGAACATCAGCTTTACTGTATGGGATGTTGGTGGACAGGACAAGaTTCGGCCTTTGTGGAGGCACTACTTCCAAAACACACAAGG...

CDS

Download CDS FASTA

552 bp · LXL04_003681|LXL04_003681|OH1004|CDS

ATGGGACTATCTTTCACGAAGCTATTCAAGCGGTTATGTGCAAAGAAAGAGATGCGTATTCTCATGGTGGGTCTTGATGCGGCTGGTAAAACCACAATCTTGTACAAGCTCAAATTGGGGGAAATTGTCACCACTATTCCTACTATTGGATTCAACGTGGAGACTGTTGAGTATAAGAACATCAGCTTTACTGTATGGGATGTTGGTGGACAGGACAAGATTCGGCCTTTGTGGAGGCACTACTTCCAAAACACACAAGG...

Protein

Download Protein FASTA

183 aa · LXL04_003681|LXL04_003681|OH1004|PROTEIN

MGLSFTKLFKRLCAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVLEAKDELHRMLSEDELKDAVLLVFANKQDLPNAMNAAEITDKLGLHSLKQRHWYIQSTCATSGEGLYEGLDWLSSNIASKSKH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003681`
TK1151 ID	TkA01G303370
OH-1004 ID	LXL04_003681
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003681

Location Chr01:94211153-94213164 (+)

Description Similar to Os01g0813400: ADP-ribosylation factor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47170`	GTP-binding protein involved in protein trafficking.	BEX1/ARF1A1C is required for BFA-sensitive recycling of PIN auxin transporters and auxin-mediated development in Arabidopsis.2014 · DOI: 10.1093/pcp/pct196

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0813400`	GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.	No verified direct reference in this release
`Os05g0489600`	GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003681 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0031001 response to brefeldin A Biological Process

GO:0090354 regulation of auxin metabolic process Biological Process

GO:0098876 vesicle-mediated transport to the plasma membrane Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G47170

dosa:Os01g0813400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.439

Rank 1 · LXL04_003681 · OH-1004

Cytoplasm0.401

Rank 2 · LXL04_003681 · OH-1004

Endoplasmic reticulum0.210

Rank 3 · LXL04_003681 · OH-1004

Cell membrane0.163

Rank 4 · LXL04_003681 · OH-1004

Lysosome / Vacuole0.138

Rank 5 · LXL04_003681 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf6-177 aa

PF09439.17SRPRB16-143 aa

PF08477.20Roc19-129 aa

PF00071.29Ras19-171 aa

PF04670.19Gtr1_RagA19-141 aa

PF00503.27G-alpha45-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003681	`PF00025.28`	Arf	6	177	6.7e-81	270.6
LXL04_003681	`PF09439.17`	SRPRB	16	143	1.5e-13	51.2
LXL04_003681	`PF08477.20`	Roc	19	129	4.7e-14	53.4
LXL04_003681	`PF00071.29`	Ras	19	171	3e-12	47.2
LXL04_003681	`PF04670.19`	Gtr1_RagA	19	141	9.5e-10	39.0
LXL04_003681	`PF00503.27`	G-alpha	45	111	3.5e-13	50.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P36397`	Arabidopsis thaliana	ADP-ribosylation factor 1	93.923%	Swiss-Prot	strong database homology
`Q06396`	Oryza sativa subsp. japonica	ADP-ribosylation factor 1	94.475%	Swiss-Prot	strong database homology
`P51823`	Oryza sativa subsp. japonica	ADP-ribosylation factor 2	93.923%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card