LXL04_003629 | RubberDandelionOmics

Gene overview

LXL04_003629

Reference: OH-1004 Chr: Chr01 Coordinates: 89664770-89680739 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1194 bp · LXL04_003629|LXL04_003629|OH1004|cDNA

atgtccgtcctgattgtagctagcaatcgtaagtggggattgtcaatcccatatagtactatatcagttttcttgttccccaaaatgtcccgaggattaacgattataagttcgggtcttaatattgtggttggagaaatgtctcacataaccttgcaaatgtttagttacctaaggtttgataaacctagtgatcatggtcaattccgtgatggtaagactcaaacaagagctagtcacagaatttctcatgatccaAA...

CDS

Download CDS FASTA

1194 bp · LXL04_003629|LXL04_003629|OH1004|CDS

ATGTCCGTCCTGATTGTAGCTAGCAATCGTAAGTGGGGATTGTCAATCCCATATAGTACTATATCAGTTTTCTTGTTCCCCAAAATGTCCCGAGGATTAACGATTATAAGTTCGGGTCTTAATATTGTGGTTGGAGAAATGTCTCACATAACCTTGCAAATGTTTAGTTACCTAAGGTTTGATAAACCTAGTGATCATGGTCAATTCCGTGATGGTAAGACTCAAACAAGAGCTAGTCACAGAATTTCTCATGATCCAAA...

Protein

Download Protein FASTA

397 aa · LXL04_003629|LXL04_003629|OH1004|PROTEIN

MSVLIVASNRKWGLSIPYSTISVFLFPKMSRGLTIISSGLNIVVGEMSHITLQMFSYLRFDKPSDHGQFRDGKTQTRASHRISHDPKVYLTPVGPKCHFRNLRGHFCKYFGTKNVRNLGPGGKNVILTKVRGQKRKFSARWSDQPCGSATLLEQLGPVPSRHLVEHLVCDQNVRNFKSRFRLRFSTNLDVVCSYLLEIKRATIAPSQFHEKEQENVPILKKVGRGGGAVAVTASDAFPASSGLALGRDVVAGVRGLEWKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003629`
TK1151 ID	TkA05G263730
OH-1004 ID	LXL04_003629
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	46.800
Protein coverage (%)	TK1151 98.870 / OH-1004 62.469 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003629

Location Chr01:89664770-89680739 (-)

Description Similar to CEL1: Endoglucanase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02290`	Endoglucanase 17.	No verified direct reference in this release
`At1g70710`	Required for cellulose formation of the cell wall.	Abnormal 'wrinkled' cell walls and retarded development of transgenic Arabidopsis thaliana plants expressing endo-1,4-beta-glucanase (cell) antisense.2003 · DOI: 10.1023/a:1021162321527
`At1g23210`	Endoglucanase 4.	No verified direct reference in this release
`At4g39010`	Endoglucanase 24.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0312800`	Endoglucanase 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003629 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009828 plant-type cell wall loosening Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0030245 cellulose catabolic process Biological Process

GO:0042547 cell wall modification involved in multidimensional cell growth Biological Process

GO:0071555 cell wall organization Biological Process

GO:1990059 fruit valve development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008810 cellulase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23210

ath:AT1G70710

ath:AT4G02290

ath:AT4G39010

dosa:Os01g0312800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.399

Rank 1 · LXL04_003629 · OH-1004

Nucleus0.283

Rank 2 · LXL04_003629 · OH-1004

Mitochondrion0.178

Rank 3 · LXL04_003629 · OH-1004

Cell membrane0.119

Rank 4 · LXL04_003629 · OH-1004

Extracellular0.108

Rank 5 · LXL04_003629 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759.26Glyco_hydro_9283-359 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003629	`PF00759.26`	Glyco_hydro_9	283	359	8.3e-24	85.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81416`	Arabidopsis thaliana	Endoglucanase 17	72.222%	Swiss-Prot	weak database homology
`Q9CAC1`	Arabidopsis thaliana	Endoglucanase 8	50.000%	Swiss-Prot	weak database homology
`O49296`	Arabidopsis thaliana	Endoglucanase 4	48.276%	Swiss-Prot	weak database homology
`Q93YQ7`	Arabidopsis thaliana	Endoglucanase 24	55.556%	Swiss-Prot	weak database homology
`Q8LQ92`	Oryza sativa subsp. japonica	Endoglucanase 3	70.833%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card