LXL04_003611 | RubberDandelionOmics

Gene overview

LXL04_003611

Reference: OH-1004 Chr: Chr01 Coordinates: 88886998-88889345 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1203 bp · LXL04_003611|LXL04_003611|OH1004|cDNA

ATGCGTAACAAACAGGTATGGCGTGTGAGTGTGTCTGATTGTAATGTCAGTTTCCCCTTGTGGACTACGCTGCTGCTCAAATTCCACCCAACCATGGCCGCCAAGAAGCTATATGATTCCTTCTCCAAGTCTCTGATCGACGAGGTTCACCGATGGGGTGCTATGAAACAGAACGGCGTCAGCCTCCGTTACATGATGGAGTTCGGCTCCAAATTCAGTGAACGTAATCTGCTCCTGGGTGCTCAATTTCTCCACAAGGA...

CDS

Download CDS FASTA

1203 bp · LXL04_003611|LXL04_003611|OH1004|CDS

ATGCGTAACAAACAGGTATGGCGTGTGAGTGTGTCTGATTGTAATGTCAGTTTCCCCTTGTGGACTACGCTGCTGCTCAAATTCCACCCAACCATGGCCGCCAAGAAGCTATATGATTCCTTCTCCAAGTCTCTGATCGACGAGGTTCACCGATGGGGTGCTATGAAACAGAACGGCGTCAGCCTCCGTTACATGATGGAGTTCGGCTCCAAATTCAGTGAACGTAATCTGCTCCTGGGTGCTCAATTTCTCCACAAGGA...

Protein

Download Protein FASTA

400 aa · LXL04_003611|LXL04_003611|OH1004|PROTEIN

MRNKQVWRVSVSDCNVSFPLWTTLLLKFHPTMAAKKLYDSFSKSLIDEVHRWGAMKQNGVSLRYMMEFGSKFSERNLLLGAQFLHKELPIRIARRAIELESLPYGLSEKPAILKVRDWYLDSFRDLRSFPDIKDMNDEQDFTKMINLIKVRHNNVVPTMALGVQQLKKDLNPKLDYKDLDDIHQFLDRFYMSRIGIRMLIGQHVALHEPNPPPDRIGYIHAKMSPVEVAKNASEDARSVCLREYGSAPDVNVYGDPDFTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003611`
TK1151 ID	TkA01G324610
OH-1004 ID	LXL04_003611
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 92.250 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003611

Location Chr01:88886998-88889345 (-)

Description Similar to PDK: [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06483`	Serine protein kinase that inhibits the mitochondrial pyruvate dehydrogenase (PDH) complex (mtPDC) by phosphorylation of the E1 alpha subunit on Ser residues, thus contributing to the regulation of glucose metabolism.	Effects of antisense repression of an Arabidopsis thaliana pyruvate dehydrogenase kinase cDNA on plant development.1999 · DOI: 10.1023/a:1006393726018 Biochemical and physiological studies of Arabidopsis thaliana transgenic lines with repressed expression of the mitochondrial pyruvate dehydrogenase kinase.2003 · DOI: 10.1093/jxb/erg020

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003611 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0006111 regulation of gluconeogenesis Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006885 regulation of pH Biological Process

GO:0010510 regulation of pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0010565 regulation of ketone metabolic process Biological Process

GO:0010906 regulation of glucose metabolic process Biological Process

GO:0018105 peptidyl-serine phosphorylation Biological Process

GO:0031670 cellular response to nutrient Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT3G06483

dme:Dmel_CG8808

mmu:18604

rno:81530

spo:2543651

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.662

Rank 1 · LXL04_003611 · OH-1004

Plastid0.332

Rank 2 · LXL04_003611 · OH-1004

Cytoplasm0.064

Rank 3 · LXL04_003611 · OH-1004

Nucleus0.042

Rank 4 · LXL04_003611 · OH-1004

Peroxisome0.019

Rank 5 · LXL04_003611 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10436.15BCDHK_Adom360-220 aa

PF02518.32HATPase_c264-389 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003611	`PF10436.15`	BCDHK_Adom3	60	220	3e-56	190.5
LXL04_003611	`PF02518.32`	HATPase_c	264	389	3e-14	54.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SBJ1`	Arabidopsis thaliana	[Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial	79.459%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card