RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_003590
Reference: OH-1004 Chr: Chr01 Coordinates: 86976073-86979454 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

939 bp · LXL04_003590|LXL04_003590|OH1004|cDNA

ATGACTAGGCTACTTGATTACAAGTACCTTAGTCTAGATGGACATACACACGGGGGTGACCGTGGCTCCTTAATTGACCAGTTCAACAAACCAGGATCTCCATTTTTCATATTCCTCCTCAGCATACGTGTTGGAGGCGTTGGAGTGAATCTTCAAGCTGCTGATACAATCATCATTTTCGACACGGATTGGAATCCACATGCAATAAATACAATTCTAAATTACAACAAAAATGTCACTATTCACATACAAAGCAAAGC...

CDS

Download CDS FASTA

939 bp · LXL04_003590|LXL04_003590|OH1004|CDS

ATGACTAGGCTACTTGATTACAAGTACCTTAGTCTAGATGGACATACACACGGGGGTGACCGTGGCTCCTTAATTGACCAGTTCAACAAACCAGGATCTCCATTTTTCATATTCCTCCTCAGCATACGTGTTGGAGGCGTTGGAGTGAATCTTCAAGCTGCTGATACAATCATCATTTTCGACACGGATTGGAATCCACATGCAATAAATACAATTCTAAATTACAACAAAAATGTCACTATTCACATACAAAGCAAAGC...

Protein

Download Protein FASTA

312 aa · LXL04_003590|LXL04_003590|OH1004|PROTEIN

MTRLLDYKYLSLDGHTHGGDRGSLIDQFNKPGSPFFIFLLSIRVGGVGVNLQAADTIIIFDTDWNPHAINTILNYNKNVTIHIQSKAVICLSPLMVGSRMYMQVLLFSTMTRLLDVMEDYLYYKQYKYLRLDGHTHGGDRGSLIDQFNKPGSPFFIFLLSIRAGGVGVNLQAADTVDLQAQARAHIIGQKKEVLVRRLETWAVNKWDKRAAIRDEQELDRMGSRWNCFLDYIWELFKVISSWINFLDYIWQLFGLHLATV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_003590
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_003590
LocationChr01:86976073-86979454 (-)
DescriptionSimilar to SYD: Chromatin structure-remodeling complex protein SYD
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g28290 Catalytic component of the chromatin structure-remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0367900 Possesses intrinsic ATP-dependent nucleosome-remodeling activity. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_003590 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process
GO:0000902 cell morphogenesis Biological Process
GO:0006334 nucleosome assembly Biological Process
GO:0006337 nucleosome disassembly Biological Process
GO:0006338 chromatin remodeling Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0006952 defense response Biological Process
GO:0008284 positive regulation of cell population proliferation Biological Process
GO:0009611 response to wounding Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0009908 flower development Biological Process
KEGG gene cross-reference
ath:AT2G28290
dosa:Os01g0367900
mmu:20586
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.439
Rank 1 · LXL04_003590 · OH-1004
Nucleus0.250
Rank 2 · LXL04_003590 · OH-1004
Mitochondrion0.143
Rank 3 · LXL04_003590 · OH-1004
Peroxisome0.094
Rank 4 · LXL04_003590 · OH-1004
Extracellular0.085
Rank 5 · LXL04_003590 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00271.38Helicase_C6-68 aa
PF00271.38Helicase_C99-176 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_003590PF00271.38Helicase_C6687.7e-2381.6
LXL04_003590PF00271.38Helicase_C991767.7e-2381.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4IHS2Arabidopsis thalianaChromatin structure-remodeling complex protein SYD69.291%Swiss-Protweak database homology
Q7G8Y3Oryza sativa subsp. japonicaProbable chromatin-remodeling complex ATPase chain58.716%Swiss-Protweak database homology

JBrowse

View in Genome Browser