LXL04_003532 | RubberDandelionOmics

Gene overview

LXL04_003532

Reference: OH-1004 Chr: Chr01 Coordinates: 82527506-82528566 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · LXL04_003532|LXL04_003532|OH1004|cDNA

ATGGAAGAGACGGCAACTAGCAGCACTCCTTCATTGTCGAGGAAGAAAGAGAAGGAGGCCATATTAAGGTTTCACAATTGCCCCGGCTGCAAAATCGACCGTCTTAAAGAGGAACGAGTTGGGTTGCCTTATGCACACCTTTCTTATATCTGGCTTGTCTCCCTCTGCACCGCTCTGCCAATTTCTTCACTATATCCGTTCATTTACTTCATGATAAGAGACTTTAATATTGCAAGTCAAGAGGAAGATATCGGTTACTA...

CDS

Download CDS FASTA

486 bp · LXL04_003532|LXL04_003532|OH1004|CDS

ATGGAAGAGACGGCAACTAGCAGCACTCCTTCATTGTCGAGGAAGAAAGAGAAGGAGGCCATATTAAGGTTTCACAATTGCCCCGGCTGCAAAATCGACCGTCTTAAAGAGGAACGAGTTGGGTTGCCTTATGCACACCTTTCTTATATCTGGCTTGTCTCCCTCTGCACCGCTCTGCCAATTTCTTCACTATATCCGTTCATTTACTTCATGATAAGAGACTTTAATATTGCAAGTCAAGAGGAAGATATCGGTTACTA...

Protein

Download Protein FASTA

161 aa · LXL04_003532|LXL04_003532|OH1004|PROTEIN

MEETATSSTPSLSRKKEKEAILRFHNCPGCKIDRLKEERVGLPYAHLSYIWLVSLCTALPISSLYPFIYFMIRDFNIASQEEDIGYYAGFVGSSFMIGRALTSLFWGVLVDRYGRKPIILVGTFSVVIFNTMFGLSSTFWMAISSRFLLGCFNSLLGTIRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003532`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003532

Location Chr01:82527506-82528566 (+)

Description Similar to ZIFL2: Probable peptide/nitrate transporter At3g43790

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43790`	Probable peptide/nitrate transporter At3g43790.	No verified direct reference in this release
`At5g13740`	Major facilitator superfamily (MFS) transporter involved in zinc tolerance by participating in vacuolar sequestration of zinc.	A novel major facilitator superfamily protein at the tonoplast influences zinc tolerance and accumulation in Arabidopsis.2007 · DOI: 10.1104/pp.106.092015
`At5g13750`	May participate in solute transport and auxin-related responses.	Heterologous expression of a Tpo1 homolog from Arabidopsis thaliana confers resistance to the herbicide 2,4-D and other chemical stresses in yeast.2009 · DOI: 10.1007/s00253-009-2025-5 A major facilitator superfamily transporter plays a dual role in polar auxin transport and drought stress tolerance in Arabidopsis.2013 · DOI: 10.1105/tpc.113.110353

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003532 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009624 response to nematode Biological Process

GO:0009630 gravitropism Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0048364 root development Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

afm:AFUA_1G15490

ath:AT3G43790

ath:AT5G13740

ath:AT5G13750

sce:YCR023C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.403

Rank 1 · LXL04_003532 · OH-1004

Endoplasmic reticulum0.217

Rank 2 · LXL04_003532 · OH-1004

Cell membrane0.190

Rank 3 · LXL04_003532 · OH-1004

Cytoplasm0.134

Rank 4 · LXL04_003532 · OH-1004

Golgi apparatus0.114

Rank 5 · LXL04_003532 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690.22MFS_150-157 aa

PF00083.31Sugar_tr76-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003532	`PF07690.22`	MFS_1	50	157	2.3e-15	57.1
LXL04_003532	`PF00083.31`	Sugar_tr	76	151	6.5e-12	45.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3EAQ5`	Arabidopsis thaliana	Probable peptide/nitrate transporter At3g43790	75.000%	Swiss-Prot	strong database homology
`Q8RWN2`	Arabidopsis thaliana	Protein ZINC INDUCED FACILITATOR 1	62.252%	Swiss-Prot	strong database homology
`Q94BZ1`	Arabidopsis thaliana	Protein ZINC INDUCED FACILITATOR-LIKE 1	65.468%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card