LXL04_003418 | RubberDandelionOmics

Gene overview

LXL04_003418

Reference: OH-1004 Chr: Chr01 Coordinates: 78099713-78101478 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

294 bp · LXL04_003418|LXL04_003418|OH1004|cDNA

ATGCAAACAGAAGGTTCGGAACAGGCAAGATCGGCAGGAACAGACACAAGAGGGAAGCATAGAATTTCTGCAGCATTGAAGAGACTTGAGCAAGAAGCTCGTTCTCTAGAGGAAGAGTTGGAACAACTTGAGAATATGGAAGCAGTTTCAGGTGTATGCAATGCAATCTTGAATGATGTGGAAAGAAGGCCCGATCCGCTACTTCCAACAACGAATGGCCCCACAAACCCAGAATGGGATAGATGGTTTGAAGGACCAAC...

CDS

Download CDS FASTA

294 bp · LXL04_003418|LXL04_003418|OH1004|CDS

ATGCAAACAGAAGGTTCGGAACAGGCAAGATCGGCAGGAACAGACACAAGAGGGAAGCATAGAATTTCTGCAGCATTGAAGAGACTTGAGCAAGAAGCTCGTTCTCTAGAGGAAGAGTTGGAACAACTTGAGAATATGGAAGCAGTTTCAGGTGTATGCAATGCAATCTTGAATGATGTGGAAAGAAGGCCCGATCCGCTACTTCCAACAACGAATGGCCCCACAAACCCAGAATGGGATAGATGGTTTGAAGGACCAAC...

Protein

Download Protein FASTA

97 aa · LXL04_003418|LXL04_003418|OH1004|PROTEIN

MQTEGSEQARSAGTDTRGKHRISAALKRLEQEARSLEEELEQLENMEAVSGVCNAILNDVERRPDPLLPTTNGPTNPEWDRWFEGPTDKSDCKCWIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003418`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003418

Location Chr01:78099713-78101478 (+)

Description Similar to GG1: Guanine nucleotide-binding protein subunit gamma 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63420`	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems.	Heterotrimeric G protein gamma subunits provide functional selectivity in Gbetagamma dimer signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050096 Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway.2009 · DOI: 10.1105/tpc.109.065557 Arabidopsis heterotrimeric G-protein regulates cell wall defense and resistance to necrotrophic fungi.2012 · DOI: 10.1093/mp/ssr082
`At3g22942`	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems.	Heterotrimeric G protein gamma subunits provide functional selectivity in Gbetagamma dimer signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050096 Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway.2009 · DOI: 10.1105/tpc.109.065557 Arabidopsis heterotrimeric G-protein regulates cell wall defense and resistance to necrotrophic fungi.2012 · DOI: 10.1093/mp/ssr082

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0635100`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.	No verified direct reference in this release
`UniProt: B8AN27`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.	No verified direct reference in this release
`Os02g0137800`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003418 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007186 G protein-coupled receptor signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0010541 acropetal auxin transport Biological Process

GO:0018342 protein prenylation Biological Process

GO:0018345 protein palmitoylation Biological Process

GO:0048527 lateral root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G22942

ath:AT3G63420

dosa:Os02g0137800

dosa:Os03g0635100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.391

Rank 1 · LXL04_003418 · OH-1004

Nucleus0.353

Rank 2 · LXL04_003418 · OH-1004

Cell membrane0.337

Rank 3 · LXL04_003418 · OH-1004

Endoplasmic reticulum0.088

Rank 4 · LXL04_003418 · OH-1004

Golgi apparatus0.070

Rank 5 · LXL04_003418 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00631.28G-gamma25-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003418	`PF00631.28`	G-gamma	25	97	1.1e-12	48.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FDX9`	Arabidopsis thaliana	Guanine nucleotide-binding protein subunit gamma 1	57.500%	Swiss-Prot	strong database homology
`Q93V47`	Arabidopsis thaliana	Guanine nucleotide-binding protein subunit gamma 2	63.095%	Swiss-Prot	strong database homology
`Q75WU1`	Oryza sativa subsp. japonica	Guanine nucleotide-binding protein subunit gamma 1	57.317%	Swiss-Prot	strong database homology
`B8AN27`	Oryza sativa subsp. indica	Guanine nucleotide-binding protein subunit gamma 1	57.317%	Swiss-Prot	strong database homology
`Q6YXX9`	Oryza sativa subsp. japonica	Guanine nucleotide-binding protein subunit gamma 2	45.055%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card