LXL04_003402 | RubberDandelionOmics

Gene overview

LXL04_003402

Reference: OH-1004 Chr: Chr01 Coordinates: 77550675-77563188 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1869 bp · LXL04_003402|LXL04_003402|OH1004|cDNA

ATGGGGCTTCTGAAGGATGACGGCGTCGTTTACAAGCCTGTCAACGAAATTGATCTCGGCCCTCACAGTGATGAAGTCTATCTCTATGCCGACGTCAAAGCTCCTCGAATGGCTGGAGCTGTTGCGAAGATATTTGTTTGGTTTCTAGAGATGAAGATCATCGGCGACGTGTTATTGTATTTTCTGAAGAAGAACAATCGAATTCAGAAGCTTGTTTCATTTGCGGTATTGAATGAATCACCACTATATGTTCCTTCGCA...

CDS

Download CDS FASTA

1869 bp · LXL04_003402|LXL04_003402|OH1004|CDS

ATGGGGCTTCTGAAGGATGACGGCGTCGTTTACAAGCCTGTCAACGAAATTGATCTCGGCCCTCACAGTGATGAAGTCTATCTCTATGCCGACGTCAAAGCTCCTCGAATGGCTGGAGCTGTTGCGAAGATATTTGTTTGGTTTCTAGAGATGAAGATCATCGGCGACGTGTTATTGTATTTTCTGAAGAAGAACAATCGAATTCAGAAGCTTGTTTCATTTGCGGTATTGAATGAATCACCACTATATGTTCCTTCGCA...

Protein

Download Protein FASTA

622 aa · LXL04_003402|LXL04_003402|OH1004|PROTEIN

MGLLKDDGVVYKPVNEIDLGPHSDEVYLYADVKAPRMAGAVAKIFVWFLEMKIIGDVLLYFLKKNNRIQKLVSFAVLNESPLYVPSQPYEEYKQMLLNADVEKGEELKCLDSGLSPAEQVQQAKGCLPSLDTRFKKSTSDESFHRWTIMDYSRAYESRQITPLMVAERFVSAVMQSSGPGADMSFFINYESHDILKQATESTLRYERGEAISILDGIPIAVKDEIDCMPYPTTGGSKWLHKLRPCKEDACCVKRLRSCGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003402`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003402

Location Chr01:77550675-77563188 (+)

Description Similar to FAAH: Fatty acid amide hydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64440`	Catalyzes the hydrolysis of bioactive endogenous fatty acid amides to their corresponding acids.	Molecular identification of a functional homologue of the mammalian fatty acid amide hydrolase in Arabidopsis thaliana.2003 · DOI: 10.1074/jbc.m305613200 Plant fatty acid (ethanol) amide hydrolases.2006 · DOI: 10.1016/j.bbalip.2006.03.004 Subcellular localization and tissue specific expression of amidase 1 from Arabidopsis thaliana.2006 · DOI: 10.1007/s00425-006-0304-2 Manipulation of Arabidopsis fatty acid amide hydrolase expression modifies plant growth and sensitivity to N-acylethanolamines.2006 · DOI: 10.1073/pnas.0603571103 Overexpression of a fatty acid amide hydrolase compromises innate immunity in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03603.x Mutations in Arabidopsis fatty acid amide hydrolase reveal that catalytic activity influences growth but not sensitivity to abscisic acid or pathogens.2009 · DOI: 10.1074/jbc.m109.059022 Overexpression of Fatty Acid Amide Hydrolase Induces Early Flowering in Arabidopsis thaliana.2012 · DOI: 10.3389/fpls.2012.00032 Plant responses to bacterial N-acyl L-homoserine lactones are dependent on enzymatic degradation to L-homoserine.2014 · DOI: 10.1021/cb500191a A chemical genetic screen uncovers a small molecule enhancer of the N-acylethanolamine degrading enzyme, fatty acid amide hydrolase, in Arabidopsis.2017 · DOI: 10.1038/srep41121

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q01N44`	Catalyzes the hydrolysis of bioactive endogenous fatty acid amides to their corresponding acids.	No verified direct reference in this release
`Os04g0102700`	Catalyzes the hydrolysis of bioactive endogenous fatty acid amides to their corresponding acids.	Plant fatty acid (ethanol) amide hydrolases.2006 · DOI: 10.1016/j.bbalip.2006.03.004

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003402 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0070291 N-acylethanolamine metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0030956 glutamyl-tRNA(Gln) amidotransferase complex Cellular Component

KEGG gene cross-reference

ath:AT5G64440

dosa:Os04g0102700

mtr:11429245

osa:4334893

sul:SYO3AOP1_0487

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.275

Rank 1 · LXL04_003402 · OH-1004

Endoplasmic reticulum0.242

Rank 2 · LXL04_003402 · OH-1004

Mitochondrion0.207

Rank 3 · LXL04_003402 · OH-1004

Peroxisome0.190

Rank 4 · LXL04_003402 · OH-1004

Nucleus0.103

Rank 5 · LXL04_003402 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01425.27Amidase193-594 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003402	`PF01425.27`	Amidase	193	594	4.5e-89	300.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJJ7`	Arabidopsis thaliana	Fatty acid amide hydrolase	43.160%	Swiss-Prot	moderate database homology
`Q01N44`	Oryza sativa subsp. indica	Fatty acid amide hydrolase	41.830%	Swiss-Prot	moderate database homology
`Q0JFH7`	Oryza sativa subsp. japonica	Fatty acid amide hydrolase	41.830%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card