LXL04_003390 | RubberDandelionOmics

Gene overview

LXL04_003390

Reference: OH-1004 Chr: Chr01 Coordinates: 77340285-77351111 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1902 bp · LXL04_003390|LXL04_003390|OH1004|cDNA

ATGTTTCTTGTTTCATCCTCTTCTCCACCATCCATGGCTACACCAGATTCATCCAGGAAATGCAAAGGCAGATCCGGAGACCATCAGTTGGACACTAAATTGACTCATTTATATGGACTCATTCACTATTCGCATCTCCATACGAAGTTATTGGTTCAATGCATCATCCTGCTTTTGCTTTTGAGTCACAGTTATTCAGACAATAAGCCTGACATCGAAGGAGAAGTTTTGATCGAGCTTCTAAAGGATCTAAATGACAC...

CDS

Download CDS FASTA

1902 bp · LXL04_003390|LXL04_003390|OH1004|CDS

ATGTTTCTTGTTTCATCCTCTTCTCCACCATCCATGGCTACACCAGATTCATCCAGGAAATGCAAAGGCAGATCCGGAGACCATCAGTTGGACACTAAATTGACTCATTTATATGGACTCATTCACTATTCGCATCTCCATACGAAGTTATTGGTTCAATGCATCATCCTGCTTTTGCTTTTGAGTCACAGTTATTCAGACAATAAGCCTGACATCGAAGGAGAAGTTTTGATCGAGCTTCTAAAGGATCTAAATGACAC...

Protein

Download Protein FASTA

633 aa · LXL04_003390|LXL04_003390|OH1004|PROTEIN

MFLVSSSSPPSMATPDSSRKCKGRSGDHQLDTKLTHLYGLIHYSHLHTKLLVQCIILLLLLSHSYSDNKPDIEGEVLIELLKDLNDTNGNIQDWNYFFVSPCYSWSHVICDHREGNVISLSLGSIGFSGTLSSSITKLKFLTKLDLHDNNLSGELPDLSSLVNLQILNLTQNKFSGSIPVSWGQLSNLKYLDLSSNNLSGKIPEKLFSTRVFNFTGTHLECGTSVPQPCISGSSVSGSTKNSKMKFVTFGVGCAALVFLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003390`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003390

Location Chr01:77340285-77351111 (+)

Description Similar to At5g63710: Probable LRR receptor-like serine/threonine-protein kinase At5g63710

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63710`	Probable LRR receptor-like serine/threonine-protein kinase At5g63710.	No verified direct reference in this release
`At5g10290`	Probable LRR receptor-like serine/threonine-protein kinase At5g10290.	No verified direct reference in this release
`At5g65240`	Probable LRR receptor-like serine/threonine-protein kinase At5g65240.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0283800`	May be involved in the regulation of plant growth through the brassinosteroid (BR) signaling pathway.	No verified direct reference in this release
`UniProt: B8BB68`	LRR receptor kinase involved in defense response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003390 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G10290

ath:AT5G63710

ath:AT5G65240

dosa:Os02g0283800

osa:4329032

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.850

Rank 1 · LXL04_003390 · OH-1004

Endoplasmic reticulum0.093

Rank 2 · LXL04_003390 · OH-1004

Cytoplasm0.078

Rank 3 · LXL04_003390 · OH-1004

Nucleus0.055

Rank 4 · LXL04_003390 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_003390 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_273-111 aa

PF12799.14LRR_4141-175 aa

PF13855.13LRR_8141-198 aa

PF12799.14LRR_4163-203 aa

PF00069.32Pkinase311-580 aa

PF07714.24PK_Tyr_Ser-Thr314-583 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003390	`PF08263.18`	LRRNT_2	73	111	6.6e-06	27.0
LXL04_003390	`PF12799.14`	LRR_4	141	175	5e-08	33.6
LXL04_003390	`PF13855.13`	LRR_8	141	198	3.7e-07	30.5
LXL04_003390	`PF12799.14`	LRR_4	163	203	5e-08	33.6
LXL04_003390	`PF00069.32`	Pkinase	311	580	4.4e-41	141.7
LXL04_003390	`PF07714.24`	PK_Tyr_Ser-Thr	314	583	3.5e-39	135.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4S5`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At5g63710	63.837%	Swiss-Prot	strong database homology
`C0LGT1`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At5g10290	54.319%	Swiss-Prot	strong database homology
`C0LGX1`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At5g65240	55.354%	Swiss-Prot	strong database homology
`Q6K4T4`	Oryza sativa subsp. japonica	LRR receptor kinase SERK2	56.860%	Swiss-Prot	strong database homology
`B8BB68`	Oryza sativa subsp. indica	LRR receptor kinase BAK1	47.903%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card