LXL04_003230 | RubberDandelionOmics

Gene overview

LXL04_003230

Reference: OH-1004 Chr: Chr01 Coordinates: 71488428-71490231 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · LXL04_003230|LXL04_003230|OH1004|cDNA

ATGAACAAATCCGACATGAGAAAGGCGTCAAAACATGAAGACGAGGCTGATTTGATCAGCAACTTGCCAGATCACGTTCTTCTTTTGATTCTCTCGGGCCTTCCTTATACCGAAGAAATAATCCGAACAAGCATTTTATCCAGACGATGGAGTATGTCGACAATTGAGCGGTGGATTCACGCCGCCGTTATGAGAAATGTCAAACAACTTGACTTGAGTTCTCCATCCCAGGGTAAGTCTGAGAATATGGTGTTGCCCCA...

CDS

Download CDS FASTA

1035 bp · LXL04_003230|LXL04_003230|OH1004|CDS

ATGAACAAATCCGACATGAGAAAGGCGTCAAAACATGAAGACGAGGCTGATTTGATCAGCAACTTGCCAGATCACGTTCTTCTTTTGATTCTCTCGGGCCTTCCTTATACCGAAGAAATAATCCGAACAAGCATTTTATCCAGACGATGGAGTATGTCGACAATTGAGCGGTGGATTCACGCCGCCGTTATGAGAAATGTCAAACAACTTGACTTGAGTTCTCCATCCCAGGGTAAGTCTGAGAATATGGTGTTGCCCCA...

Protein

Download Protein FASTA

344 aa · LXL04_003230|LXL04_003230|OH1004|PROTEIN

MNKSDMRKASKHEDEADLISNLPDHVLLLILSGLPYTEEIIRTSILSRRWSMSTIERWIHAAVMRNVKQLDLSSPSQGKSENMVLPHCASLEVLSLCFRDRRLILPRFSGFPVLRVLKLMYFELLDGDTVADFLKSCPMLEDLTLDICSLDKLDGLCISCPKLKKLRIFECHLRGCFKINCPKLVFLDLTQASNFIFERLHSLKEARIGCKFKDIPGLFPGFFHVESLSTKLNFLYECIDGERDPALPNLKTLFLSTSDA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003230`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003230

Location Chr01:71488428-71490231 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10400`	FBD-associated F-box protein At4g10400.	No verified direct reference in this release
`At5g56690`	Putative FBD-associated F-box protein At5g56690.	No verified direct reference in this release
`At5g56700`	Putative FBD-associated F-box protein At5g56700.	No verified direct reference in this release
`At4g15060`	Putative F-box/LRR-repeat protein At4g15060.	No verified direct reference in this release
`At5g02700`	Putative F-box/LRR-repeat protein At5g02700.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003230 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT4G10400

ath:AT4G15060

ath:AT5G02700

ath:AT5G56690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.870

Rank 1 · LXL04_003230 · OH-1004

Cytoplasm0.178

Rank 2 · LXL04_003230 · OH-1004

Cell membrane0.044

Rank 3 · LXL04_003230 · OH-1004

Endoplasmic reticulum0.038

Rank 4 · LXL04_003230 · OH-1004

Plastid0.014

Rank 5 · LXL04_003230 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box19-51 aa

PF23622.2LRR_At1g61320_AtMIF150-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003230	`PF00646.39`	F-box	19	51	1e-05	25.9
LXL04_003230	`PF23622.2`	LRR_At1g61320_AtMIF1	50	286	5.7e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV82`	Arabidopsis thaliana	FBD-associated F-box protein At4g10400	26.934%	Swiss-Prot	weak database homology
`Q9FJU3`	Arabidopsis thaliana	Putative FBD-associated F-box protein At5g56690	26.172%	Swiss-Prot	weak database homology
`Q9FJU2`	Arabidopsis thaliana	Putative FBD-associated F-box protein At5g56700	26.765%	Swiss-Prot	weak database homology
`O23360`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At4g15060	25.352%	Swiss-Prot	weak database homology
`Q9LZ15`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At5g02700	27.004%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card