LXL04_003222 | RubberDandelionOmics

Gene overview

LXL04_003222

Reference: OH-1004 Chr: Chr01 Coordinates: 71325117-71328579 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

810 bp · LXL04_003222|LXL04_003222|OH1004|cDNA

ATGAAGTCGAATGTAGATGCAAAATGGAATCGCGGCTTGATTTGGTTCGATTATGTTCCTGATTTTTTGCTCAGAGCATTGAATtCTAGAACATTGCAAAAATTAATGAGATTTGAATTTTCGGAAACCATgcgggaaaatatgGCTGAGATTGAATTAGGTGATGTCATGTGGCATTTGtcaaaattaaCCTTGCTTCGAGGTCTGAAGTATCTTCACTCCGCTAATGTACTCCATCGTGACCTAAAACCCGGAAATCT...

CDS

Download CDS FASTA

810 bp · LXL04_003222|LXL04_003222|OH1004|CDS

ATGAAGTCGAATGTAGATGCAAAATGGAATCGCGGCTTGATTTGGTTCGATTATGTTCCTGATTTTTTGCTCAGAGCATTGAATTCTAGAACATTGCAAAAATTAATGAGATTTGAATTTTCGGAAACCATGCGGGAAAATATGGCTGAGATTGAATTAGGTGATGTCATGTGGCATTTGTCAAAATTAACCTTGCTTCGAGGTCTGAAGTATCTTCACTCCGCTAATGTACTCCATCGTGACCTAAAACCCGGAAATCT...

Protein

Download Protein FASTA

269 aa · LXL04_003222|LXL04_003222|OH1004|PROTEIN

MKSNVDAKWNRGLIWFDYVPDFLLRALNSRTLQKLMRFEFSETMRENMAEIELGDVMWHLSKLTLLRGLKYLHSANVLHRDLKPGNLLVNANCELKICDFGLARTSQGSEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSDLQGWKQIESYFSWPRRTPQDDRLASPSIRQRFEAIDCNNCCFMKSPIDCCSSLFEAKGKKGAKTNERDAIVLKLKNGETMMDESMTRDRCILIKNSNILTLKKKLKVQPQDSVTPQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003222`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003222

Location Chr01:71325117-71328579 (-)

Description Similar to MPK7: Mitogen-activated protein kinase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18170`	MKK3-MPK7 module acts as a positive regulator of PR1 gene expression.	The Arabidopsis mitogen-activated protein kinase kinase MKK3 is upstream of group C mitogen-activated protein kinases and participates in pathogen signaling.2007 · DOI: 10.1105/tpc.106.050039
`At1g59580`	Mitogen-activated protein kinase 2.	No verified direct reference in this release
`At1g10210`	Mitogen-activated protein kinase 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003222 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009611 response to wounding Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10210

ath:AT1G59580

ath:AT2G18170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.432

Rank 1 · LXL04_003222 · OH-1004

Cytoplasm0.430

Rank 2 · LXL04_003222 · OH-1004

Mitochondrion0.162

Rank 3 · LXL04_003222 · OH-1004

Cell membrane0.070

Rank 4 · LXL04_003222 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_003222 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr43-142 aa

PF00069.32Pkinase64-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003222	`PF07714.24`	PK_Tyr_Ser-Thr	43	142	3e-14	53.7
LXL04_003222	`PF00069.32`	Pkinase	64	142	1.5e-28	100.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39027`	Arabidopsis thaliana	Mitogen-activated protein kinase 7	96.154%	Swiss-Prot	weak database homology
`Q39022`	Arabidopsis thaliana	Mitogen-activated protein kinase 2	91.026%	Swiss-Prot	weak database homology
`Q39021`	Arabidopsis thaliana	Mitogen-activated protein kinase 1	89.744%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card