LXL04_003213 | RubberDandelionOmics

Gene overview

LXL04_003213

Reference: OH-1004 Chr: Chr01 Coordinates: 71051075-71063452 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2832 bp · LXL04_003213|LXL04_003213|OH1004|cDNA

ATGGCTGGATATTTGGTTCCAGAAACCAgtcgatggtttgagaagaaaagaaggaagaagaagaaactcaTCCCAAGAGCTAGAAGAAgatatgcaaaagattggaatgtttggaactcccaaggAGAGAAGGGAGAAGATACGGTCATTGTAGAAGAGAATAAGGAAGAAAAGGAGACACCGATTACCTTCAAGAATTGCCATGCTAATATTGACATGCTATGGTGTTCGGTTGAGGAAGAAACACAGCGATATGGTGG...

CDS

Download CDS FASTA

2832 bp · LXL04_003213|LXL04_003213|OH1004|CDS

ATGGCTGGATATTTGGTTCCAGAAACCAGTCGATGGTTTGAGAAGAAAAGAAGGAAGAAGAAGAAACTCATCCCAAGAGCTAGAAGAAGATATGCAAAAGATTGGAATGTTTGGAACTCCCAAGGAGAGAAGGGAGAAGATACGGTCATTGTAGAAGAGAATAAGGAAGAAAAGGAGACACCGATTACCTTCAAGAATTGCCATGCTAATATTGACATGCTATGGTGTTCGGTTGAGGAAGAAACACAGCGATATGGTGG...

Protein

Download Protein FASTA

943 aa · LXL04_003213|LXL04_003213|OH1004|PROTEIN

MAGYLVPETSRWFEKKRRKKKKLIPRARRRYAKDWNVWNSQGEKGEDTVIVEENKEEKETPITFKNCHANIDMLWCSVEEETQRYGGGGGLQPSLEKERGWRRNQMHNLSRFTNKKEKSKAKDNRGQSFPPKFRNPNLHSTTEGCEPLSHLTTPVTSIPITEVGMKNSEGPKTSKGEDGVDFISNMPDAILVLILSRLSSTEEQIRSSILSRRWRYLWTAVPTVDMQFLSGEESKQSKFKEFMYWVLASKTVNLDSFRLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003213`
TK1151 ID	TkA01G384750
OH-1004 ID	LXL04_003213
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.700
Protein coverage (%)	TK1151 94.715 / OH-1004 25.769 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003213

Location Chr01:71051075-71063452 (+)

Description Similar to At1g16930: F-box/FBD/LRR-repeat protein At1g16930

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16930`	F-box/FBD/LRR-repeat protein At1g16930.	No verified direct reference in this release
`At4g00160`	F-box/FBD/LRR-repeat protein At4g00160.	No verified direct reference in this release
`At3g26922`	F-box/LRR-repeat protein At3g26922.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At5g56700`	Putative FBD-associated F-box protein At5g56700.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003213 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G16930

ath:AT3G26922

ath:AT4G00160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.542

Rank 1 · LXL04_003213 · OH-1004

Cytoplasm0.482

Rank 2 · LXL04_003213 · OH-1004

Cell membrane0.079

Rank 3 · LXL04_003213 · OH-1004

Endoplasmic reticulum0.063

Rank 4 · LXL04_003213 · OH-1004

Mitochondrion0.033

Rank 5 · LXL04_003213 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box183-220 aa

PF23622.2LRR_At1g61320_AtMIF1253-465 aa

PF24758.2LRR_At5g56370272-390 aa

PF24758.2LRR_At5g56370692-805 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003213	`PF00646.39`	F-box	183	220	7.4e-11	42.2
LXL04_003213	`PF23622.2`	LRR_At1g61320_AtMIF1	253	465	2.2e-15	57.6
LXL04_003213	`PF24758.2`	LRR_At5g56370	272	390	3.4e-25	89.7
LXL04_003213	`PF24758.2`	LRR_At5g56370	692	805	3.4e-25	89.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ52`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At1g16930	31.140%	Swiss-Prot	weak database homology
`Q8LF09`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At4g00160	30.165%	Swiss-Prot	weak database homology
`Q9LJF8`	Arabidopsis thaliana	F-box/LRR-repeat protein At3g26922	31.276%	Swiss-Prot	weak database homology
`Q6NKX3`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At2g04230	33.898%	Swiss-Prot	weak database homology
`Q9FJU2`	Arabidopsis thaliana	Putative FBD-associated F-box protein At5g56700	34.615%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card