LXL04_003199 | RubberDandelionOmics

Gene overview

LXL04_003199

Reference: OH-1004 Chr: Chr01 Coordinates: 70697785-70701166 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1167 bp · LXL04_003199|LXL04_003199|OH1004|cDNA

atgtgtgtgtgtgtgtgtgtctaCACAAGGCCAGACAAAATCCACGCAATCTCAATTTACGACAACAAGAAATTAGGGTTCATATCACATTTGAAAACAAGGTATAAGATGGCATTGGGAAAGAACTACAGCTTAGGGCTAGTAAAACGTACTAGTTCATTTGGTAGAAAGAGGATTCTGATCTTGAACGAAATGGATATCGATTCTATTAATGCCATTTCCCCCACGAAGAAACGATCAATGGGAAACAATTTCAGTCC...

CDS

Download CDS FASTA

1167 bp · LXL04_003199|LXL04_003199|OH1004|CDS

ATGTGTGTGTGTGTGTGTGTCTACACAAGGCCAGACAAAATCCACGCAATCTCAATTTACGACAACAAGAAATTAGGGTTCATATCACATTTGAAAACAAGGTATAAGATGGCATTGGGAAAGAACTACAGCTTAGGGCTAGTAAAACGTACTAGTTCATTTGGTAGAAAGAGGATTCTGATCTTGAACGAAATGGATATCGATTCTATTAATGCCATTTCCCCCACGAAGAAACGATCAATGGGAAACAATTTCAGTCC...

Protein

Download Protein FASTA

388 aa · LXL04_003199|LXL04_003199|OH1004|PROTEIN

MCVCVCVYTRPDKIHAISIYDNKKLGFISHLKTRYKMALGKNYSLGLVKRTSSFGRKRILILNEMDIDSINAISPTKKRSMGNNFSPRKSLLEALPQDILIRILCGVEHDDLKKLFHVSKPIREAEEDPGWYSRAANFISEPVVDVEMNHNVNMELPSKNEISLPETKTIPHENGNSVETHDKDVMVEGLSSVVVYDQWVDPPVSGQRPKPRYEHAAAVIDDKMYIFGGNHNGRYLNDLQVEVKPNSEAPVTVTPCAGHS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003199`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003199

Location Chr01:70697785-70701166 (-)

Description Similar to ACBP4: Acyl-CoA-binding domain-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05420`	Binds medium- and long-chain acyl-CoA esters with very high affinity.	ACBP4 and ACBP5, novel Arabidopsis acyl-CoA-binding proteins with kelch motifs that bind oleoyl-CoA.2004 · DOI: 10.1007/s11103-004-0642-z Arabidopsis acyl-CoA-binding proteins ACBP4 and ACBP5 are subcellularly localized to the cytosol and ACBP4 depletion affects membrane lipid composition.2008 · DOI: 10.1007/s11103-008-9392-7
`At5g27630`	Binds medium- and long-chain acyl-CoA esters with very high affinity.	ACBP4 and ACBP5, novel Arabidopsis acyl-CoA-binding proteins with kelch motifs that bind oleoyl-CoA.2004 · DOI: 10.1007/s11103-004-0642-z
`At1g61340`	F-box protein At1g61340.	No verified direct reference in this release
`At4g05010`	F-box protein At4g05010.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0835600`	Binds medium- and long-chain acyl-CoA esters with high affinity.	The rice acyl-CoA-binding protein gene family: phylogeny, expression and functional analysis.2011 · DOI: 10.1111/j.1469-8137.2010.03546.x Subcellular localization of rice acyl-CoA-binding proteins (ACBPs) indicates that OsACBP6::GFP is targeted to the peroxisomes.2014 · DOI: 10.1111/nph.12809

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003199 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006869 lipid transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009961 response to 1-aminocyclopropane-1-carboxylic acid Biological Process

KEGG gene cross-reference

ath:AT1G61340

ath:AT3G05420

ath:AT4G05010

ath:AT5G27630

dosa:Os03g0835600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.499

Rank 1 · LXL04_003199 · OH-1004

Cytoplasm0.307

Rank 2 · LXL04_003199 · OH-1004

Cell membrane0.111

Rank 3 · LXL04_003199 · OH-1004

Endoplasmic reticulum0.084

Rank 4 · LXL04_003199 · OH-1004

Mitochondrion0.081

Rank 5 · LXL04_003199 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13415.13Beta-prop_FBX42192-239 aa

PF24681.2Kelch_KLHDC2_KLHL20_DRC7197-285 aa

PF24981.2Beta-prop_ATRN-LZTR1197-240 aa

PF01344.32Kelch_1211-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003199	`PF13415.13`	Beta-prop_FBX42	192	239	2.2e-09	38.0
LXL04_003199	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	197	285	2.8e-13	50.4
LXL04_003199	`PF24981.2`	Beta-prop_ATRN-LZTR1	197	240	2.1e-07	31.2
LXL04_003199	`PF01344.32`	Kelch_1	211	239	2.7e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA55`	Arabidopsis thaliana	Acyl-CoA-binding domain-containing protein 4	54.286%	Swiss-Prot	weak database homology
`Q8RWD9`	Arabidopsis thaliana	Acyl-CoA-binding domain-containing protein 5	48.851%	Swiss-Prot	weak database homology
`Q8GX77`	Arabidopsis thaliana	F-box protein At1g61340	45.556%	Swiss-Prot	weak database homology
`Q9S9T6`	Arabidopsis thaliana	F-box protein At4g05010	41.584%	Swiss-Prot	weak database homology
`Q75LJ4`	Oryza sativa subsp. japonica	Acyl-CoA-binding domain-containing protein 6	54.494%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card