LXL04_003158 | RubberDandelionOmics

Gene overview

LXL04_003158

Reference: OH-1004 Chr: Chr01 Coordinates: 69525150-69527369 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1746 bp · LXL04_003158|LXL04_003158|OH1004|cDNA

ATGAGTAAAGAAGAGTTCGTGAAGATTCAGACTTGTACTCTGAAAGTGAACATCCACTGTGATGGCTGCAAGCGAAAAGTGAAGAAAATCCTTCAGAAAACGGAGGGAGTTTACACCATCAAAATAGATCCAGAACAGGGGAAGGTTACAGTATCAGGAGATGTTGATCCAGCCACGCTCATCAAGAGGCTTGCTAAAAGCGGAAAGCTTGCGGAAGTTTGGGGTGCCCCAAACGCGAAGCCAAATCCACAGATCAACAA...

CDS

Download CDS FASTA

1746 bp · LXL04_003158|LXL04_003158|OH1004|CDS

ATGAGTAAAGAAGAGTTCGTGAAGATTCAGACTTGTACTCTGAAAGTGAACATCCACTGTGATGGCTGCAAGCGAAAAGTGAAGAAAATCCTTCAGAAAACGGAGGGAGTTTACACCATCAAAATAGATCCAGAACAGGGGAAGGTTACAGTATCAGGAGATGTTGATCCAGCCACGCTCATCAAGAGGCTTGCTAAAAGCGGAAAGCTTGCGGAAGTTTGGGGTGCCCCAAACGCGAAGCCAAATCCACAGATCAACAA...

Protein

Download Protein FASTA

581 aa · LXL04_003158|LXL04_003158|OH1004|PROTEIN

MSKEEFVKIQTCTLKVNIHCDGCKRKVKKILQKTEGVYTIKIDPEQGKVTVSGDVDPATLIKRLAKSGKLAEVWGAPNAKPNPQINNQFKNMQIDGGKGGGGGGGGGAGNNKNQAQKGGGNNNNNQQQQGKGQPPPHQGGGPTPQQLQQFQQLQQMKGFQDLKMHPQFKDMKMPPFGGGGGGGGKNVQKSVKVVEEDDGSEDDYDDDDDDFDDDDYDEDDEEFDDEMDDVPVKKPMMMGGGGPQGQMANMLPQLMKSGQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003158`
TK1151 ID	TkA01G390490
OH-1004 ID	LXL04_003158
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003158

Location Chr01:69525150-69527369 (-)

Description Similar to HIPP32: Heavy metal-associated isoprenylated plant protein 32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06130`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g19090`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g05220`	Heavy-metal-binding protein.	No verified direct reference in this release
`At1g23000`	Heavy-metal-binding protein.	No verified direct reference in this release
`At1g56210`	Heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003158 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G23000

ath:AT3G05220

ath:AT3G06130

ath:AT5G19090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.516

Rank 1 · LXL04_003158 · OH-1004

Nucleus0.442

Rank 2 · LXL04_003158 · OH-1004

Cell membrane0.193

Rank 3 · LXL04_003158 · OH-1004

Endoplasmic reticulum0.074

Rank 4 · LXL04_003158 · OH-1004

Extracellular0.039

Rank 5 · LXL04_003158 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403.33HMA13-69 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003158	`PF00403.33`	HMA	13	69	2e-15	57.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8K5`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 32	64.535%	Swiss-Prot	weak database homology
`F4JZL7`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 33	71.552%	Swiss-Prot	weak database homology
`Q0WV37`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 34	54.082%	Swiss-Prot	weak database homology
`A2RVM8`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 37	50.000%	Swiss-Prot	weak database homology
`Q9C7J6`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 35	60.317%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card