LXL04_003147 | RubberDandelionOmics

Gene overview

LXL04_003147

Reference: OH-1004 Chr: Chr01 Coordinates: 69240096-69242120 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

672 bp · LXL04_003147|LXL04_003147|OH1004|cDNA

ATGGCCCCTTCCTCCTTTTCCTCTTCCACCACAACCgcccaccaccaccacctcaaCAAAAAGTCCTCTTCCTCATCttcaaaccctaaccctaacaATTGCACAAGCACTTGCTCTCATCATTCGCCCTCCGCGACTCTCGATATCTTAATCCTCATCCTAGTCCTATTTTCCGGCGCTTTTTTAGTCTCTTCCTACTTCTCCTACATCTTCCATTCTCTCTCCCTTATCCTCCCGCCTATTTCTCTCTCTATCCTTAT...

CDS

Download CDS FASTA

672 bp · LXL04_003147|LXL04_003147|OH1004|CDS

ATGGCCCCTTCCTCCTTTTCCTCTTCCACCACAACCGCCCACCACCACCACCTCAACAAAAAGTCCTCTTCCTCATCTTCAAACCCTAACCCTAACAATTGCACAAGCACTTGCTCTCATCATTCGCCCTCCGCGACTCTCGATATCTTAATCCTCATCCTAGTCCTATTTTCCGGCGCTTTTTTAGTCTCTTCCTACTTCTCCTACATCTTCCATTCTCTCTCCCTTATCCTCCCGCCTATTTCTCTCTCTATCCTTAT...

Protein

Download Protein FASTA

223 aa · LXL04_003147|LXL04_003147|OH1004|PROTEIN

MAPSSFSSSTTTAHHHHLNKKSSSSSSNPNPNNCTSTCSHHSPSATLDILILILVLFSGAFLVSSYFSYIFHSLSLILPPISLSILIDISSLYLIGFFLFFVLSIIGLEICCGNRSRKCGKKGCKGLKKEMEFDLQLQTEEILRSGAKGVKEMEELPWKGGSETNPDYECLRTELRKMAPMNGRAVLLFRSKCGCPVAKLEGWGPKRGRRNKKNMSLNGGSHG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003147`
TK1151 ID	TkAUNG041190
OH-1004 ID	LXL04_003147
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 87.619 / OH-1004 41.256 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003147

Location Chr01:69240096-69242120 (-)

Description Similar to At5g19025: Uncharacterized protein At5g19025

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19025`	Uncharacterized protein At5g19025.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003147 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G19025

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.454

Rank 1 · LXL04_003147 · OH-1004

Endoplasmic reticulum0.307

Rank 2 · LXL04_003147 · OH-1004

Cell membrane0.181

Rank 3 · LXL04_003147 · OH-1004

Cytoplasm0.156

Rank 4 · LXL04_003147 · OH-1004

Plastid0.059

Rank 5 · LXL04_003147 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28125.1At5g19025_N46-117 aa

PF30682.1At5g19025_C132-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003147	`PF28125.1`	At5g19025_N	46	117	4.5e-20	73.0
LXL04_003147	`PF30682.1`	At5g19025_C	132	202	6.9e-41	138.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C8Q9`	Arabidopsis thaliana	Uncharacterized protein At5g19025	59.314%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card