LXL04_003094 | RubberDandelionOmics

Gene overview

LXL04_003094

Reference: OH-1004 Chr: Chr01 Coordinates: 67288723-67292555 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2283 bp · LXL04_003094|LXL04_003094|OH1004|cDNA

ATGGATACAAATGGTAAAAGCTCAAAAACAGGGGAGATCAGCATGTCGGAGAGCAAAAGCAGCGAAGTGGTCATACCAATCTCCGGCGAAGATAGATATGCAAAACTCACTAATTTTGGAGTGCTGAGAGATGCAAACCGAAGAGGTGTTAGAAAATCCGTTGATTCAGATCCTGAAACAGCACATTCTATGCCAACCCCTAACTTATCTCCTAAAACCCCAAATCCTGAAACTTTAAGAAGGAGAAAAACCATGTCAAG...

CDS

Download CDS FASTA

2283 bp · LXL04_003094|LXL04_003094|OH1004|CDS

ATGGATACAAATGGTAAAAGCTCAAAAACAGGGGAGATCAGCATGTCGGAGAGCAAAAGCAGCGAAGTGGTCATACCAATCTCCGGCGAAGATAGATATGCAAAACTCACTAATTTTGGAGTGCTGAGAGATGCAAACCGAAGAGGTGTTAGAAAATCCGTTGATTCAGATCCTGAAACAGCACATTCTATGCCAACCCCTAACTTATCTCCTAAAACCCCAAATCCTGAAACTTTAAGAAGGAGAAAAACCATGTCAAG...

Protein

Download Protein FASTA

760 aa · LXL04_003094|LXL04_003094|OH1004|PROTEIN

MDTNGKSSKTGEISMSESKSSEVVIPISGEDRYAKLTNFGVLRDANRRGVRKSVDSDPETAHSMPTPNLSPKTPNPETLRRRKTMSRLIHSKPKSRFGEQPLINPEIFNDNIPDPVTQTSNSSMRISNRASPTGTPLTETARTTSITPKTPLKQSPPGQGVDDDEEIYKKVKIRRQLKLKKVKTKVLLQWILLLLLVGCLVASLMIPKLDNFIIWDLELWKWFALMTVIICGMLVTNWLMNFIVLLIEMNFLLRKKVLYF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003094`
TK1151 ID	TkA01G394300
OH-1004 ID	LXL04_003094
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003094

Location Chr01:67288723-67292555 (-)

Description Similar to MSL10: Mechanosensitive ion channel protein 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g12080`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	Two MscS homologs provide mechanosensitive channel activities in the Arabidopsis root.2008 · DOI: 10.1016/j.cub.2008.04.039 AtMSL9 and AtMSL10: Sensors of plasma membrane tension in Arabidopsis roots.2008 · DOI: 10.4161/psb.3.9.6487
`At5g19520`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	Two MscS homologs provide mechanosensitive channel activities in the Arabidopsis root.2008 · DOI: 10.1016/j.cub.2008.04.039 AtMSL9 and AtMSL10: Sensors of plasma membrane tension in Arabidopsis roots.2008 · DOI: 10.4161/psb.3.9.6487
`At1g78610`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	No verified direct reference in this release
`At1g53470`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	No verified direct reference in this release
`At2g17010`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003094 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0009846 pollen germination Biological Process

GO:0009859 pollen hydration Biological Process

GO:0010150 leaf senescence Biological Process

GO:0050982 detection of mechanical stimulus Biological Process

GO:0097468 programmed cell death in response to reactive oxygen species Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0090406 pollen tube Cellular Component

KEGG gene cross-reference

ath:AT1G53470

ath:AT1G78610

ath:AT2G17010

ath:AT5G12080

ath:AT5G19520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.819

Rank 1 · LXL04_003094 · OH-1004

Endoplasmic reticulum0.106

Rank 2 · LXL04_003094 · OH-1004

Cytoplasm0.079

Rank 3 · LXL04_003094 · OH-1004

Lysosome / Vacuole0.047

Rank 4 · LXL04_003094 · OH-1004

Golgi apparatus0.036

Rank 5 · LXL04_003094 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25886.1Msy1176-331 aa

PF00924.25MS_channel_2nd589-645 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003094	`PF25886.1`	Msy1	176	331	1.6e-10	41.9
LXL04_003094	`PF00924.25`	MS_channel_2nd	589	645	1.1e-11	45.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYG9`	Arabidopsis thaliana	Mechanosensitive ion channel protein 10	51.394%	Swiss-Prot	strong database homology
`Q84M97`	Arabidopsis thaliana	Mechanosensitive ion channel protein 9	49.008%	Swiss-Prot	moderate database homology
`Q9SYM1`	Arabidopsis thaliana	Mechanosensitive ion channel protein 6	43.370%	Swiss-Prot	moderate database homology
`Q9LPG3`	Arabidopsis thaliana	Mechanosensitive ion channel protein 4	37.949%	Swiss-Prot	moderate database homology
`F4IME2`	Arabidopsis thaliana	Mechanosensitive ion channel protein 8	41.186%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card