Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1257 bp · LXL04_003088|LXL04_003088|OH1004|cDNA
ATGGCCAAAACAGAACGAAACGACGATGCCATGCCTTTGGAGATAGAAACAGAATCTCCAAAAGTCCCTAACGATCTTCCAAATGAAAAGAAGACCGAAACAGTATCAAATCAAGATGAAGACGAAAGCGCAATTCAACACGACAAGGGCAATTTAGGAAACAATGATAATTCAGTAACAAAAGACaagaaaaagaggaaaaaaGAATCCACGGAAGAAGATCCGGAACCAAAAAAAGAGACGAAAAGGAAACGAAGATC...
1257 bp · LXL04_003088|LXL04_003088|OH1004|CDS
ATGGCCAAAACAGAACGAAACGACGATGCCATGCCTTTGGAGATAGAAACAGAATCTCCAAAAGTCCCTAACGATCTTCCAAATGAAAAGAAGACCGAAACAGTATCAAATCAAGATGAAGACGAAAGCGCAATTCAACACGACAAGGGCAATTTAGGAAACAATGATAATTCAGTAACAAAAGACAAGAAAAAGAGGAAAAAAGAATCCACGGAAGAAGATCCGGAACCAAAAAAAGAGACGAAAAGGAAACGAAGATC...
Protein
Download Protein FASTA418 aa · LXL04_003088|LXL04_003088|OH1004|PROTEIN
MAKTERNDDAMPLEIETESPKVPNDLPNEKKTETVSNQDEDESAIQHDKGNLGNNDNSVTKDKKKRKKESTEEDPEPKKETKRKRRSKKETVSDKTYNLIRGKRFTPEEDEIVKESVLDYIKAHDLGPEGITKILNCSSYPEVKNCWKEIGSRLPNRPKTTIYYRAHILFEQDEKRKWTKEETEFLQQSYKKHGNNWKLVAEELGKHRIHVKDKWRRIKLDTKKSGRWTQEEYQGLYNLVNFNLQMKVVSEKKSKHGMLR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_003088 |
|---|---|
| TK1151 ID | TkA01G394920 |
| OH-1004 ID | LXL04_003088 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 94.000 |
| Protein coverage (%) | TK1151 91.429 / OH-1004 83.732Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_003088 |
|---|---|
| Location | Chr01:67189127-67192534 (+) |
| Description | Similar to LOX1: Lipoxygenase 1, chloroplastic |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006633 fatty acid biosynthetic process Biological Process GO:0008299 isoprenoid biosynthetic process Biological Process GO:0031408 oxylipin biosynthetic process Biological Process GO:0034440 lipid oxidation Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component |
| KEGG gene cross-reference | hsa:9988 mmu:23857 rno:114485 sot:102597498 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00249.38Myb_DNA-binding175-218 aaPF13921.13Myb_DNA-bind_6178-236 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_003088 | PF00249.38 | Myb_DNA-binding | 175 | 218 | 2.9e-17 | 63.2 |
| LXL04_003088 | PF13921.13 | Myb_DNA-bind_6 | 178 | 236 | 1.1e-17 | 64.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.