LXL04_003051 | RubberDandelionOmics

Gene overview

LXL04_003051

Reference: OH-1004 Chr: Chr01 Coordinates: 65832438-65835587 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

897 bp · LXL04_003051|LXL04_003051|OH1004|cDNA

ATGGATTCTTCAGATATAGAGCTGCTTCCTGCTATTCAGGATGTTTTGCTGGAGTTTCGTGCTGGTAAAATGCATTTGGAAGGAACACGTGTTGTTGCTGATCCACGTAAAGGACTTGTCCGCATTGGAAGAGGGGAGGAGGGTTTAGTTCATATTCAGTGGCTTGATAGGAGTACCAACACCATTGAAGATGACCAGATTGTTTTCCCAGAGGAGGCAGTTTTTGAGAGGGTCGGTCAAGCTTCTGGAAGGGTTTACTT...

CDS

Download CDS FASTA

897 bp · LXL04_003051|LXL04_003051|OH1004|CDS

ATGGATTCTTCAGATATAGAGCTGCTTCCTGCTATTCAGGATGTTTTGCTGGAGTTTCGTGCTGGTAAAATGCATTTGGAAGGAACACGTGTTGTTGCTGATCCACGTAAAGGACTTGTCCGCATTGGAAGAGGGGAGGAGGGTTTAGTTCATATTCAGTGGCTTGATAGGAGTACCAACACCATTGAAGATGACCAGATTGTTTTCCCAGAGGAGGCAGTTTTTGAGAGGGTCGGTCAAGCTTCTGGAAGGGTTTACTT...

Protein

Download Protein FASTA

298 aa · LXL04_003051|LXL04_003051|OH1004|PROTEIN

MDSSDIELLPAIQDVLLEFRAGKMHLEGTRVVADPRKGLVRIGRGEEGLVHIQWLDRSTNTIEDDQIVFPEEAVFERVGQASGRVYLLKFETDGRKCFFWMQEPRADDDEELCKSVNLYLNQPLEFPTEEENTLGEDISSRAGDLVGVGPSTGAEMISDVSSSGPVKLSDLQRILSNIGPAGAGEVEDPDGGLGLGDILKPELILPLMETLSLDQVASHLPEGQWSPEELMELLQSPPFRQQVDSFTYVLKTGQIDLTQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003051`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003051

Location Chr01:65832438-65835587 (-)

Description Similar to RPN13: 26S proteasome regulatory subunit RPN13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26590`	Functions as a proteasomal ubiquitin receptor.	The defective proteasome but not substrate recognition function is responsible for the null phenotypes of the Arabidopsis proteasome subunit RPN10.2011 · DOI: 10.1105/tpc.111.086702

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003051 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0043248 proteasome assembly Biological Process

GO:0061136 regulation of proteasomal protein catabolic process Biological Process

GO:0071357 cellular response to type I interferon Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G26590

hsa:11047

xtr:394646

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.673

Rank 1 · LXL04_003051 · OH-1004

Nucleus0.509

Rank 2 · LXL04_003051 · OH-1004

Cell membrane0.071

Rank 3 · LXL04_003051 · OH-1004

Endoplasmic reticulum0.066

Rank 4 · LXL04_003051 · OH-1004

Golgi apparatus0.066

Rank 5 · LXL04_003051 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04683.20Rpn13_ADRM1_Pru16-113 aa

PF16550.11RPN13_C172-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003051	`PF04683.20`	Rpn13_ADRM1_Pru	16	113	1.4e-30	106.4
LXL04_003051	`PF16550.11`	RPN13_C	172	278	3.9e-24	85.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48726`	Arabidopsis thaliana	26S proteasome regulatory subunit RPN13	64.286%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card