LXL04_002874 | RubberDandelionOmics

Gene overview

LXL04_002874

Reference: OH-1004 Chr: Chr01 Coordinates: 60046183-60046681 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

330 bp · LXL04_002874|LXL04_002874|OH1004|cDNA

ATGTTATATTTACAGGTTAACGTTCCAAAGACAAAGAAGACTTACTGCAAGAATAAAGATTGCAGAAAGCATACTTTGCACAAGGTGACACAGTACAAGAAGGGTAAAGACAGCTTGGCTGCACAAGGAAAACGCCGTTATGACAGGAAGCAATCTGGTTATGGTGGACAGACAAAGCCTGTCTTCCACAAGAAGGCTAAAACCACAAAGAAGATTGTGCTAAGGTTGCAGTGCCAAGGTTGCAAGCATGTCTCACAGCA...

CDS

Download CDS FASTA

330 bp · LXL04_002874|LXL04_002874|OH1004|CDS

ATGTTATATTTACAGGTTAACGTTCCAAAGACAAAGAAGACTTACTGCAAGAATAAAGATTGCAGAAAGCATACTTTGCACAAGGTGACACAGTACAAGAAGGGTAAAGACAGCTTGGCTGCACAAGGAAAACGCCGTTATGACAGGAAGCAATCTGGTTATGGTGGACAGACAAAGCCTGTCTTCCACAAGAAGGCTAAAACCACAAAGAAGATTGTGCTAAGGTTGCAGTGCCAAGGTTGCAAGCATGTCTCACAGCA...

Protein

Download Protein FASTA

109 aa · LXL04_002874|LXL04_002874|OH1004|PROTEIN

MLYLQVNVPKTKKTYCKNKDCRKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHPIKRCKHFEIGGDKKGKGTSLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002874`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002874

Location Chr01:60046183-60046681 (-)

Description Similar to RPL44: 60S ribosomal protein L44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: O23290`	Large ribosomal subunit protein eL42z/eL42y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002874 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0046677 response to antibiotic Biological Process

GO:0046898 response to cycloheximide Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT3G23390

ath:AT4G14320

cel:CELE_C09H10.2

ghi:107886824

ghi:107894041

ghi:107898862

ghi:107918511

ghi:107946105

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.650

Rank 1 · LXL04_002874 · OH-1004

Nucleus0.256

Rank 2 · LXL04_002874 · OH-1004

Endoplasmic reticulum0.069

Rank 3 · LXL04_002874 · OH-1004

Mitochondrion0.049

Rank 4 · LXL04_002874 · OH-1004

Extracellular0.015

Rank 5 · LXL04_002874 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00935.26Ribosomal_L4423-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002874	`PF00935.26`	Ribosomal_L44	23	98	1e-33	116.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23290`	Arabidopsis thaliana	Large ribosomal subunit protein eL42z/eL42y	93.269%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card