LXL04_002835 | RubberDandelionOmics

Gene overview

LXL04_002835

Reference: OH-1004 Chr: Chr01 Coordinates: 59334027-59336229 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2013 bp · LXL04_002835|LXL04_002835|OH1004|cDNA

ATGAAGCAGGATATTTTCGGAATTGCACTTTTCTCTCCCGCCTCCAGAACAATCTCttcGTTGATGGCTACGAAGGCAGATAAAGCAATCGGAATAGACCTTGGTACAACTTATAGTTGTGTCGGGGTATGGCAGAACGACCGCGTGGAGATCATTCCAAACGATCAAGGCAACCGCACAACCCCTTCTTATGTCGCGTTTACCGACACCGAACGGTTGATTGGCGACGCCGCTAAGAACCAGGTGGCGATGAACCCACA...

CDS

Download CDS FASTA

2013 bp · LXL04_002835|LXL04_002835|OH1004|CDS

ATGAAGCAGGATATTTTCGGAATTGCACTTTTCTCTCCCGCCTCCAGAACAATCTCTTCGTTGATGGCTACGAAGGCAGATAAAGCAATCGGAATAGACCTTGGTACAACTTATAGTTGTGTCGGGGTATGGCAGAACGACCGCGTGGAGATCATTCCAAACGATCAAGGCAACCGCACAACCCCTTCTTATGTCGCGTTTACCGACACCGAACGGTTGATTGGCGACGCCGCTAAGAACCAGGTGGCGATGAACCCACA...

Protein

Download Protein FASTA

670 aa · LXL04_002835|LXL04_002835|OH1004|PROTEIN

MKQDIFGIALFSPASRTISSLMATKADKAIGIDLGTTYSCVGVWQNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRRFTDPSVQSDMKLWPFKVISGPGEKPMIVVNYKGEEKQFAPEEISSMVLVKMKETAEAFLGQTIKNAVVTVPAYFNDSQRQATKDAGAISGLNVMRIINEPTAAAIAYGLDKKSSRKGEQNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002835`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002835

Location Chr01:59334027-59336229 (-)

Description Similar to HSP70: Heat shock 70 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16030`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At3g12580`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions (Probable).	Comprehensive expression profile analysis of the Arabidopsis Hsp70 gene family.2001 · DOI: 10.1104/pp.126.2.789 Heat shock protein cognate 70-4 and an E3 ubiquitin ligase, CHIP, mediate plastid-destined precursor degradation through the ubiquitin-26S proteasome system in Arabidopsis.2009 · DOI: 10.1105/tpc.109.071548

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002835 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006457 protein folding Biological Process

GO:0006950 response to stress Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009408 response to heat Biological Process

GO:0009615 response to virus Biological Process

GO:0009617 response to bacterium Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042026 protein refolding Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G16030

ath:AT3G12580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.592

Rank 1 · LXL04_002835 · OH-1004

Nucleus0.301

Rank 2 · LXL04_002835 · OH-1004

Mitochondrion0.129

Rank 3 · LXL04_002835 · OH-1004

Cell membrane0.120

Rank 4 · LXL04_002835 · OH-1004

Endoplasmic reticulum0.108

Rank 5 · LXL04_002835 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012.27HSP7029-638 aa

PF06723.20MreB_Mbl162-400 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002835	`PF00012.27`	HSP70	29	638	2.8e-261	868.7
LXL04_002835	`PF06723.20`	MreB_Mbl	162	400	2.3e-15	57.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9N1`	Arabidopsis thaliana	Heat shock 70 kDa protein 5	85.077%	Swiss-Prot	strong database homology
`Q9LHA8`	Arabidopsis thaliana	Heat shock 70 kDa protein 4	84.793%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card