LXL04_002818 | RubberDandelionOmics

Gene overview

LXL04_002818

Reference: OH-1004 Chr: Chr01 Coordinates: 58902174-58903318 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

615 bp · LXL04_002818|LXL04_002818|OH1004|cDNA

ATGAGTTCGAGATCGTTGTTTTTGTGTTTGACTGCTGTTCTGGTATTGTTCTCCATGAATCTTGATAGCTCCGAAGCAACAGAGTTTAGGGTTGGTGGAAACAAGGAGAACGCGTGGCGTATCCCTACGGCTCCTAACGAGTTGAATGAATGGGCTGGAAAGGAACGATTTAGAATCGGAGATTCGCTTGTGTTCAAATACGACTCAAAGGTGGATTCAGTGTTACAAGTGGGTGAAGAAGGCTACAAGAAATGCAACAA...

CDS

Download CDS FASTA

615 bp · LXL04_002818|LXL04_002818|OH1004|CDS

ATGAGTTCGAGATCGTTGTTTTTGTGTTTGACTGCTGTTCTGGTATTGTTCTCCATGAATCTTGATAGCTCCGAAGCAACAGAGTTTAGGGTTGGTGGAAACAAGGAGAACGCGTGGCGTATCCCTACGGCTCCTAACGAGTTGAATGAATGGGCTGGAAAGGAACGATTTAGAATCGGAGATTCGCTTGTGTTCAAATACGACTCAAAGGTGGATTCAGTGTTACAAGTGGGTGAAGAAGGCTACAAGAAATGCAACAA...

Protein

Download Protein FASTA

204 aa · LXL04_002818|LXL04_002818|OH1004|PROTEIN

MSSRSLFLCLTAVLVLFSMNLDSSEATEFRVGGNKENAWRIPTAPNELNEWAGKERFRIGDSLVFKYDSKVDSVLQVGEEGYKKCNKSSPIKSYQDGNTMIKLDKAGPFFFISGATGNCEKGEKLEVKVLSPKHAGSVSAPSPSQAPKSSPIVTPRPLLTPASAPPVVTPATAPAAASSAGSSVVVIGFSTMVVMSTLFAVAMV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002818`
TK1151 ID	TkA01G418710
OH-1004 ID	LXL04_002818
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002818

Location Chr01:58902174-58903318 (-)

Description Similar to At2g25060: Early nodulin-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23990`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At5g57920`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At4g31840`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At2g25060`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At4g30590`	May act as a carbohydrate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002818 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0009055 electron transfer activity Molecular Function

KEGG gene cross-reference

ath:AT2G23990

ath:AT2G25060

ath:AT4G30590

ath:AT4G31840

ath:AT5G57920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.750

Rank 1 · LXL04_002818 · OH-1004

Extracellular0.140

Rank 2 · LXL04_002818 · OH-1004

Endoplasmic reticulum0.092

Rank 3 · LXL04_002818 · OH-1004

Cytoplasm0.067

Rank 4 · LXL04_002818 · OH-1004

Golgi apparatus0.043

Rank 5 · LXL04_002818 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298.24Cu_bind_like39-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002818	`PF02298.24`	Cu_bind_like	39	122	6.9e-26	90.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82227`	Arabidopsis thaliana	Early nodulin-like protein 11	43.000%	Swiss-Prot	moderate database homology
`Q8L6Z5`	Arabidopsis thaliana	Early nodulin-like protein 10	53.279%	Swiss-Prot	moderate database homology
`Q9SZ51`	Arabidopsis thaliana	Early nodulin-like protein 15	46.053%	Swiss-Prot	moderate database homology
`Q9SK27`	Arabidopsis thaliana	Early nodulin-like protein 14	44.667%	Swiss-Prot	moderate database homology
`Q9M0A1`	Arabidopsis thaliana	Early nodulin-like protein 12	46.528%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card