LXL04_002795 | RubberDandelionOmics

Gene overview

LXL04_002795

Reference: OH-1004 Chr: Chr01 Coordinates: 58415606-58419541 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2469 bp · LXL04_002795|LXL04_002795|OH1004|cDNA

ATGGAACCGGCACCGGCATCGGAACCAGACATGATTTCTTTTAGTCGGGCCGGTTCCATAATTTTACAGTTTTCGGTTTCGGTTCCAGAGTCGGTTCAGTCCAGTTCGGGTCGATATTATCCATGCAAGATTAAAAAAGGTATGATCAGGGAGTTACTCTTTGGTTTCCTGTTGATTCATTCATCTCTAGCCAAACATGGACACCCCGGTAATCACAAACCTACAAGACGGACCCGGTTGCAAGCTATGCCTGCTATTGT...

CDS

Download CDS FASTA

2469 bp · LXL04_002795|LXL04_002795|OH1004|CDS

ATGGAACCGGCACCGGCATCGGAACCAGACATGATTTCTTTTAGTCGGGCCGGTTCCATAATTTTACAGTTTTCGGTTTCGGTTCCAGAGTCGGTTCAGTCCAGTTCGGGTCGATATTATCCATGCAAGATTAAAAAAGGTATGATCAGGGAGTTACTCTTTGGTTTCCTGTTGATTCATTCATCTCTAGCCAAACATGGACACCCCGGTAATCACAAACCTACAAGACGGACCCGGTTGCAAGCTATGCCTGCTATTGT...

Protein

Download Protein FASTA

822 aa · LXL04_002795|LXL04_002795|OH1004|PROTEIN

MEPAPASEPDMISFSRAGSIILQFSVSVPESVQSSSGRYYPCKIKKGMIRELLFGFLLIHSSLAKHGHPGNHKPTRRTRLQAMPAIVPGTGPAKKWLTLNGGEPLVIAQGGSPGLFPDSSVAGYTAGIAMGVIGTLKYCNLQLTKDNLGVCLANIKMDNCTNAAERFPKHQRRYSVNGRDIDGWFPLDFTIDQIMKEIRLIQNIYSRASVFDFVYPLVQPDSVWGMEPKGHLWLNVQNDAFFSSHQLNVIRYIEDSNKFF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002795`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002795

Location Chr01:58415606-58419541 (-)

Description Similar to GDPDL7: Glycerophosphodiester phosphodiesterase GDPDL7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58170`	Glycerophosphodiester phosphodiesterase GDPDL7.	No verified direct reference in this release
`At5g58050`	Glycerophosphodiester phosphodiesterase GDPDL6.	No verified direct reference in this release
`At4g26690`	Involved in primary cell wall organization.	The glycerophosphoryl diester phosphodiesterase-like proteins SHV3 and its homologs play important roles in cell wall organization.2008 · DOI: 10.1093/pcp/pcn120
`At5g55480`	Involved in primary cell wall organization.	The glycerophosphoryl diester phosphodiesterase-like proteins SHV3 and its homologs play important roles in cell wall organization.2008 · DOI: 10.1093/pcp/pcn120
`At1g66980`	Atypical receptor-like kinase involved in disease resistance.	Activation of plant immune responses by a gain-of-function mutation in an atypical receptor-like kinase.2010 · DOI: 10.1104/pp.110.158501

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002795 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006071 glycerol metabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0006968 cellular defense response Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0045087 innate immune response Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G66980

ath:AT4G26690

ath:AT5G55480

ath:AT5G58050

ath:AT5G58170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.475

Rank 1 · LXL04_002795 · OH-1004

Cell membrane0.344

Rank 2 · LXL04_002795 · OH-1004

Endoplasmic reticulum0.088

Rank 3 · LXL04_002795 · OH-1004

Cytoplasm0.079

Rank 4 · LXL04_002795 · OH-1004

Golgi apparatus0.044

Rank 5 · LXL04_002795 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03009.24GDPD427-715 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002795	`PF03009.24`	GDPD	427	715	3.4e-32	113.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVN0`	Arabidopsis thaliana	Glycerophosphodiester phosphodiesterase GDPDL7	51.862%	Swiss-Prot	strong database homology
`Q9FGT9`	Arabidopsis thaliana	Glycerophosphodiester phosphodiesterase GDPDL6	52.594%	Swiss-Prot	strong database homology
`Q9SZ11`	Arabidopsis thaliana	Glycerophosphodiester phosphodiesterase GDPDL3	40.689%	Swiss-Prot	moderate database homology
`Q9FJ62`	Arabidopsis thaliana	Glycerophosphodiester phosphodiesterase GDPDL4	41.224%	Swiss-Prot	moderate database homology
`D7SFH9`	Arabidopsis thaliana	Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4	41.076%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card