LXL04_002784 | RubberDandelionOmics

Gene overview

LXL04_002784

Reference: OH-1004 Chr: Chr01 Coordinates: 58228824-58233007 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2541 bp · LXL04_002784|LXL04_002784|OH1004|cDNA

ATGGCTGATAATTCCATGGATCAAATCAAAAATAACGAagttgatcttgagaaaatcCCTATCGAAGAATTGTTCAAGAGCTTGAAGTGTACCAGGGATGGGTTGAGCGACGATGAAGGTGCCAGGAGGCTCGAAATATTTGGGCCTAATAAGCTCCAGGAGAAAAAGGAAAGTAAACTGCTCAAGTTTCTAGGGTTCATGTGGAACCCCCTTTCGTGGGTGATGGAAATTGCAGCGATCATGGCGATTGTTTTGGCCAA...

CDS

Download CDS FASTA

2541 bp · LXL04_002784|LXL04_002784|OH1004|CDS

ATGGCTGATAATTCCATGGATCAAATCAAAAATAACGAAGTTGATCTTGAGAAAATCCCTATCGAAGAATTGTTCAAGAGCTTGAAGTGTACCAGGGATGGGTTGAGCGACGATGAAGGTGCCAGGAGGCTCGAAATATTTGGGCCTAATAAGCTCCAGGAGAAAAAGGAAAGTAAACTGCTCAAGTTTCTAGGGTTCATGTGGAACCCCCTTTCGTGGGTGATGGAAATTGCAGCGATCATGGCGATTGTTTTGGCCAA...

Protein

Download Protein FASTA

846 aa · LXL04_002784|LXL04_002784|OH1004|PROTEIN

MADNSMDQIKNNEVDLEKIPIEELFKSLKCTRDGLSDDEGARRLEIFGPNKLQEKKESKLLKFLGFMWNPLSWVMEIAAIMAIVLANGGGRPPDWPDFVGIVVLLLINSTISFIEENNAGNAASALMASLAPKCKVLRNGKWSEQEASILVPGDMISVKLGDIIPADARLLEGDMLKIDQAALTGESLPVTKNPGDAVYSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQSGHFQQVLTDIGNFCICSIAVGMIIE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002784`
TK1151 ID	TkA01G421010
OH-1004 ID	LXL04_002784
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002784

Location Chr01:58228824-58233007 (-)

Description Similar to AHA8: ATPase 8, plasma membrane-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g42640`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At2g07560`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At1g80660`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At5g57350`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0656100`	The plasma membrane ATPase of plants and fungi is a hydrogen ion pump.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002784 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0051453 regulation of intracellular pH Biological Process

GO:0120029 proton export across plasma membrane Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G80660

ath:AT2G07560

ath:AT3G42640

ath:AT5G57350

dosa:Os04g0656100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.627

Rank 1 · LXL04_002784 · OH-1004

Endoplasmic reticulum0.138

Rank 2 · LXL04_002784 · OH-1004

Lysosome / Vacuole0.126

Rank 3 · LXL04_002784 · OH-1004

Cytoplasm0.094

Rank 4 · LXL04_002784 · OH-1004

Golgi apparatus0.070

Rank 5 · LXL04_002784 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00690.32Cation_ATPase_N18-81 aa

PF00122.26E1-E2_ATPase130-229 aa

PF00702.33Hydrolase326-598 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002784	`PF00690.32`	Cation_ATPase_N	18	81	1.1e-15	57.8
LXL04_002784	`PF00122.26`	E1-E2_ATPase	130	229	1.2e-32	112.4
LXL04_002784	`PF00702.33`	Hydrolase	326	598	2.7e-12	48.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2A0`	Arabidopsis thaliana	ATPase 8, plasma membrane-type	80.851%	Swiss-Prot	strong database homology
`Q9SH76`	Arabidopsis thaliana	ATPase 6, plasma membrane-type	78.892%	Swiss-Prot	strong database homology
`Q42556`	Arabidopsis thaliana	ATPase 9, plasma membrane-type	79.009%	Swiss-Prot	strong database homology
`P20431`	Arabidopsis thaliana	ATPase 3, plasma membrane-type	78.369%	Swiss-Prot	strong database homology
`Q7XPY2`	Oryza sativa subsp. japonica	Plasma membrane ATPase	78.698%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card