LXL04_002781 | RubberDandelionOmics

Gene overview

LXL04_002781

Reference: OH-1004 Chr: Chr01 Coordinates: 58213306-58213923 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

618 bp · LXL04_002781|LXL04_002781|OH1004|cDNA

ATGGTCATCCATGGATACCCAGATTTGTTATTCAATCAAAAATCATGGATCGCTCTCAACACCGGTAGCTTTTTGTTTAGAAATTGTCAATGGTCTTTGGATTTACTCGATGAATGGGCACCAATGGGGCCAAAAGGGCCTGTTCGTGAAGAAGCTGGCAAGATTTTAACAACCAATTTGAAAGGTCGGCCTGCTTTTGAAGCTGGCGATCAATCTGTCCTAATTTACTTATTGATTACAAAAACCGAATGGATGAAAAA...

CDS

Download CDS FASTA

618 bp · LXL04_002781|LXL04_002781|OH1004|CDS

ATGGTCATCCATGGATACCCAGATTTGTTATTCAATCAAAAATCATGGATCGCTCTCAACACCGGTAGCTTTTTGTTTAGAAATTGTCAATGGTCTTTGGATTTACTCGATGAATGGGCACCAATGGGGCCAAAAGGGCCTGTTCGTGAAGAAGCTGGCAAGATTTTAACAACCAATTTGAAAGGTCGGCCTGCTTTTGAAGCTGGCGATCAATCTGTCCTAATTTACTTATTGATTACAAAAACCGAATGGATGAAAAA...

Protein

Download Protein FASTA

205 aa · LXL04_002781|LXL04_002781|OH1004|PROTEIN

MVIHGYPDLLFNQKSWIALNTGSFLFRNCQWSLDLLDEWAPMGPKGPVREEAGKILTTNLKGRPAFEAGDQSVLIYLLITKTEWMKKVFVENSYFLHGYGAGLVDRYEEMMEKYHHGLGDERWPFVTHFVGCKPCGSYGDYPVQRCLSSMERAFNFADNQMLKLYGFRHKELLSPTIKRIRNETVTPLENVDQFDIRHLAQGTSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002781`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002781

Location Chr01:58213306-58213923 (+)

Description Similar to XXT3: Probable xyloglucan 6-xylosyltransferase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07720`	Probable xyloglucan xylosyltransferase involved in the biosynthesis of xyloglucan.	No verified direct reference in this release
`At1g74380`	Probable xyloglucan xylosyltransferase involved in the biosynthesis of xyloglucan in roots.	Arabidopsis XXT5 gene encodes a putative alpha-1,6-xylosyltransferase that is involved in xyloglucan biosynthesis.2008 · DOI: 10.1111/j.1365-313x.2008.03580.x Protein-protein interactions among xyloglucan-synthesizing enzymes and formation of Golgi-localized multiprotein complexes.2015 · DOI: 10.1093/pcp/pcu161
`At1g18690`	Xylosyltransferase specific to UDP-D-xylose that accepts cellohexaose as substrate to produce xyloglucan.	Arabidopsis GT34 family contains five xyloglucan α-1,6-xylosyltransferases.2012 · DOI: 10.1111/j.1469-8137.2012.04196.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0529600`	Probable glycosyltransferase that may be involved in the biosynthesis of xyloglucan.	No verified direct reference in this release
`UniProt: B8AIZ4`	Probable glycosyltransferase that may be involved in the biosynthesis of xyloglucan.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002781 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009969 xyloglucan biosynthetic process Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0048767 root hair elongation Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016758 hexosyltransferase activity Molecular Function

GO:0033843 xyloglucan 6-xylosyltransferase activity Molecular Function

GO:0035252 UDP-xylosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18690

ath:AT1G74380

ath:AT5G07720

dosa:Os02g0529600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.780

Rank 1 · LXL04_002781 · OH-1004

Endoplasmic reticulum0.119

Rank 2 · LXL04_002781 · OH-1004

Cytoplasm0.083

Rank 3 · LXL04_002781 · OH-1004

Extracellular0.067

Rank 4 · LXL04_002781 · OH-1004

Cell membrane0.060

Rank 5 · LXL04_002781 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05637.19Glyco_transf_342-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002781	`PF05637.19`	Glyco_transf_34	2	137	1.7e-23	84.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF80`	Arabidopsis thaliana	Probable xyloglucan 6-xylosyltransferase 3	81.910%	Swiss-Prot	strong database homology
`Q9CA75`	Arabidopsis thaliana	Probable xyloglucan 6-xylosyltransferase 5	81.818%	Swiss-Prot	strong database homology
`Q9M9U0`	Arabidopsis thaliana	Xyloglucan 6-xylosyltransferase 4	77.451%	Swiss-Prot	strong database homology
`Q6H765`	Oryza sativa subsp. japonica	Probable glycosyltransferase 2	74.146%	Swiss-Prot	strong database homology
`B8AIZ4`	Oryza sativa subsp. indica	Probable glycosyltransferase 2	74.146%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card