LXL04_002779 | RubberDandelionOmics

Gene overview

LXL04_002779

Reference: OH-1004 Chr: Chr01 Coordinates: 58201183-58205523 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1818 bp · LXL04_002779|LXL04_002779|OH1004|cDNA

ATGCTGAACTACCCTGCAACTTCTTCATTCAATTGCCAAAATACCCGATTCACACCACCTCCAGGTTACGCTCTCCACCCCTCATCTCTCACACTATCATCATCGTCGTCGTCGTCGTCGCCTTCATCATTGCACTCTTCTTCTCAATACCACCAAAACCTTCCTTCAGTCAATGCTTACAAGCACACCCGTTTCAATATCTCCCCACGAACAAAGGGACTGAAGGTGAGGTGCTCACAAAATGAGCCGTTGAAGGTTAT...

CDS

Download CDS FASTA

1818 bp · LXL04_002779|LXL04_002779|OH1004|CDS

ATGCTGAACTACCCTGCAACTTCTTCATTCAATTGCCAAAATACCCGATTCACACCACCTCCAGGTTACGCTCTCCACCCCTCATCTCTCACACTATCATCATCGTCGTCGTCGTCGTCGCCTTCATCATTGCACTCTTCTTCTCAATACCACCAAAACCTTCCTTCAGTCAATGCTTACAAGCACACCCGTTTCAATATCTCCCCACGAACAAAGGGACTGAAGGTGAGGTGCTCACAAAATGAGCCGTTGAAGGTTAT...

Protein

Download Protein FASTA

605 aa · LXL04_002779|LXL04_002779|OH1004|PROTEIN

MLNYPATSSFNCQNTRFTPPPGYALHPSSLTLSSSSSSSSPSSLHSSSQYHQNLPSVNAYKHTRFNISPRTKGLKVRCSQNEPLKVMISGAPASGKGTQCEMIVQKFGLVHISTGDLLRSEVAAGSEIGNQAKEFMNSGRLVPDELVTNMVIERLSRDDTKQKGWLLDGFPRSFPQAQSLEKMKIRPDVFIALDVPDETLIDRCVGRRLDPETGKIYHIKNFPPETEEIKARLITRPDDTEEKVKSRLQIYKQNVEAIVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002779`
TK1151 ID	TkA01G421130
OH-1004 ID	LXL04_002779
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002779

Location Chr01:58201183-58205523 (+)

Description Similar to At5g35170: Adenylate kinase 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35170`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release
`At5g47840`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0288200`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release
`Os08g0109300`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002779 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0097009 energy homeostasis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004017 AMP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G35170

ath:AT5G47840

dosa:Os08g0109300

dosa:Os08g0288200

osa:4345177

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · LXL04_002779 · OH-1004

Mitochondrion0.038

Rank 2 · LXL04_002779 · OH-1004

Cytoplasm0.029

Rank 3 · LXL04_002779 · OH-1004

Peroxisome0.022

Rank 4 · LXL04_002779 · OH-1004

Nucleus0.019

Rank 5 · LXL04_002779 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00406.30ADK88-264 aa

PF13207.13AAA_1790-208 aa

PF09353.16DUF1995337-579 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002779	`PF00406.30`	ADK	88	264	6e-50	170.0
LXL04_002779	`PF13207.13`	AAA_17	90	208	2.8e-29	102.8
LXL04_002779	`PF09353.16`	DUF1995	337	579	1e-40	140.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYL1`	Arabidopsis thaliana	Adenylate kinase 5, chloroplastic	71.898%	Swiss-Prot	strong database homology
`Q9FIJ7`	Arabidopsis thaliana	Adenylate kinase 2, chloroplastic	58.228%	Swiss-Prot	weak database homology
`Q0J6P7`	Oryza sativa subsp. japonica	Probable adenylate kinase 5, chloroplastic	65.996%	Swiss-Prot	strong database homology
`Q6ZC69`	Oryza sativa subsp. japonica	Probable adenylate kinase 2, chloroplastic	62.212%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card