Gene Card
Gene overview
cDNA / CDS / Protein Sequences
436 bp · LXL04_002675|LXL04_002675|OH1004|cDNA
TATATCAGTAGTTCGTATTCGGTTTCTGAAGTAATTCGGTTTCTTTTCGCAGACAGGAGAAACTGTGAATCCGAAAGCTTACCCACTGGCTGACGCTCAGCTCACAATTACGATATTGGATCTTGTTCAACAAGCCGCTAATTATAAGCAGCTTAAAAAGGGTGCCAATGAAGCTACAAAGACCCTCAACAGGGGTATATCCGAGTTTGTAGTGATGGCAGCAGATGCTGAACCTCTTGAAATTATTCTCCATCTTCCCC...
351 bp · LXL04_002675|LXL04_002675|OH1004|CDS
CTGGCTGACGCTCAGCTCACAATTACGATATTGGATCTTGTTCAACAAGCCGCTAATTATAAGCAGCTTAAAAAGGGTGCCAATGAAGCTACAAAGACCCTCAACAGGGGTATATCCGAGTTTGTAGTGATGGCAGCAGATGCTGAACCTCTTGAAATTATTCTCCATCTTCCCCTTCTTGCTGAAGACAAGAATGTTCCATATGTGTTTGTGCCCTCAAAGGAAGCCCTAGGTCGTGCTTGTGGGGTCACAAGGGCCGT...
Protein
Download Protein FASTA116 aa · LXL04_002675|LXL04_002675|OH1004|PROTEIN
MADAQLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFVVMAADAEPLEIILHLPLLAEDKNVPYVFVPSKEALGRACGVTRAVIACSVTSNEGSQLRSQIQQLKDAIEKLLI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002675 |
|---|---|
| TK1151 ID | TkA01G430900 |
| OH-1004 ID | LXL04_002675 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 99.100 |
| Protein coverage (%) | TK1151 90.625 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002675 |
|---|---|
| Location | Chr01:54449902-54450798 (+) |
| Description | Similar to snu13: NHP2-like protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0000452 snoRNA guided rRNA 2'-O-methylation Biological Process GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000494 box C/D sno(s)RNA 3'-end processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005690 U4atac snRNP Cellular Component GO:0005730 nucleolus Cellular Component GO:0031428 box C/D methylation guide snoRNP complex Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0046540 U4/U6 x U5 tri-snRNP complex Cellular Component |
| KEGG gene cross-reference | spo:2542663 uma:UMAG_06360 xla:495253 xtr:394590 yli:2908708 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01248.32Ribosomal_L7Ae11-99 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002675 | PF01248.32 | Ribosomal_L7Ae | 11 | 99 | 2.2e-27 | 95.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.