Gene Card
Gene overview
cDNA / CDS / Protein Sequences
396 bp · LXL04_002658|LXL04_002658|OH1004|cDNA
ATGAGCAGCGGAGACTGGATGTGTAGTGCATGTGAGCATATGAATTTCAAGAAACGAGATGCTTGTCAACGATGTCACTGCCCAAAGTTTGCAACCGCCGAAGAGGTTTCATGTTATGGGATGAACAGAACGGAGGTTTTGGCCGGTGATTGGTATTGTGCCACATTCAACTGTGGGACACACAATTATGCTAGTAGAAACGCATGTTATAGGTGTGGAGGTGTCAAAGATTATAGCGCTATGATGGCCGCAACAACGGG...
396 bp · LXL04_002658|LXL04_002658|OH1004|CDS
ATGAGCAGCGGAGACTGGATGTGTAGTGCATGTGAGCATATGAATTTCAAGAAACGAGATGCTTGTCAACGATGTCACTGCCCAAAGTTTGCAACCGCCGAAGAGGTTTCATGTTATGGGATGAACAGAACGGAGGTTTTGGCCGGTGATTGGTATTGTGCCACATTCAACTGTGGGACACACAATTATGCTAGTAGAAACGCATGTTATAGGTGTGGAGGTGTCAAAGATTATAGCGCTATGATGGCCGCAACAACGGG...
Protein
Download Protein FASTA131 aa · LXL04_002658|LXL04_002658|OH1004|PROTEIN
MSSGDWMCSACEHMNFKKRDACQRCHCPKFATAEEVSCYGMNRTEVLAGDWYCATFNCGTHNYASRNACYRCGGVKDYSAMMAATTGACYGYDTSVVPGWKTGDWICNRYGCGVHNYASRMECYKCKTPRE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002658 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002658 |
|---|---|
| Location | Chr01:54169646-54170139 (-) |
| Description | Similar to ZRANB2: Zinc finger Ran-binding domain-containing protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0031445 regulation of heterochromatin formation Biological Process GO:0071502 cellular response to temperature stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005694 chromosome Cellular Component GO:0005737 cytoplasm Cellular Component GO:0010494 cytoplasmic stress granule Cellular Component GO:0140453 protein aggregate center Cellular Component GO:0000175 3'-5'-RNA exonuclease activity Molecular Function GO:0003729 mRNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function |
| KEGG gene cross-reference | afm:AFUA_5G02160 ani:ANIA_08055 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00641.24Zn_ribbon_RanBP3-29 aaPF00641.24Zn_ribbon_RanBP48-76 aaPF00641.24Zn_ribbon_RanBP101-131 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002658 | PF00641.24 | Zn_ribbon_RanBP | 3 | 29 | 1.3e-17 | 63.5 |
| LXL04_002658 | PF00641.24 | Zn_ribbon_RanBP | 48 | 76 | 1.3e-17 | 63.5 |
| LXL04_002658 | PF00641.24 | Zn_ribbon_RanBP | 101 | 131 | 1.3e-17 | 63.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.