RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_002643
Reference: OH-1004 Chr: Chr01 Coordinates: 53622120-53627500 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2664 bp · LXL04_002643|LXL04_002643|OH1004|cDNA

ATGGCGGAAATATTTGATAGTCACGCAAAGAGTGGAGGTTTTAGGGTTTCATTGTGCGGTGGCGCTCAGGAACTAGAACAGATGTCTAGAGACGGCAGTCAATACAGTCTCACCACTGCAATCTTACCTTCGCTCGGAGCTCGCAGCAACCGCCGTGTTAAACTTCGAAATTTCATTATATCTCCTTATGATCGCCGTTACAGGGCATGGGAGACATATCTAGTGGTTTTAGTCCTTTATACAGCATGGGCATCACCATT...

CDS

Download CDS FASTA

2664 bp · LXL04_002643|LXL04_002643|OH1004|CDS

ATGGCGGAAATATTTGATAGTCACGCAAAGAGTGGAGGTTTTAGGGTTTCATTGTGCGGTGGCGCTCAGGAACTAGAACAGATGTCTAGAGACGGCAGTCAATACAGTCTCACCACTGCAATCTTACCTTCGCTCGGAGCTCGCAGCAACCGCCGTGTTAAACTTCGAAATTTCATTATATCTCCTTATGATCGCCGTTACAGGGCATGGGAGACATATCTAGTGGTTTTAGTCCTTTATACAGCATGGGCATCACCATT...

Protein

Download Protein FASTA

887 aa · LXL04_002643|LXL04_002643|OH1004|PROTEIN

MAEIFDSHAKSGGFRVSLCGGAQELEQMSRDGSQYSLTTAILPSLGARSNRRVKLRNFIISPYDRRYRAWETYLVVLVLYTAWASPFEFGYLKRPRKPLSIIDNIVNGFFAIDIILTFFLAYLDKSTYLLVDDRKKIAWKYTSTWLAFDVISTIPSELVRKLSSRSFQAYGLFNMCRLWRLRRASALFARLEKDRNFNYFWVRCAKLIAVTLFAVHCAGCFYYYLAAHYPNPGKTWIGYGNEGFEKESLWIRYVTSMYWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_002643
TK1151 IDTkA01G433710
OH-1004 IDLXL04_002643
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_002643
LocationChr01:53622120-53627500 (-)
DescriptionSimilar to AKT1: Potassium channel AKT1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g26650 May act as a highly selective inward-rectifying potassium channel mediating root potassium uptake under low K⁺ conditions.
Regulated expression of Arabidopsis shaker K+ channel genes involved in K+ uptake and distribution in the plant.2003 · DOI: 10.1023/a:1022597102282
A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011
A Ca(2)+ signaling pathway regulates a K(+) channel for low-K response in Arabidopsis.2006 · DOI: 10.1073/pnas.0605129103
A protein phosphorylation/dephosphorylation network regulates a plant potassium channel.2007 · DOI: 10.1073/pnas.0707912104
High-affinity K(+) transport in Arabidopsis: AtHAK5 and AKT1 are vital for seedling establishment and postgermination growth under low-potassium conditions.2010 · DOI: 10.1104/pp.110.154369
A role for the AKT1 potassium channel in plant nutrition.1998 · DOI: 10.1126/science.280.5365.918
At2g25600 Highly selective inward-rectifying potassium channel that could mediate potassium uptake in the pollen membrane.
Pollen tube development and competitive ability are impaired by disruption of a Shaker K(+) channel in Arabidopsis.2002 · DOI: 10.1101/gad.213902
At4g32500 Probable potassium channel. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: P0C550 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots. No verified direct reference in this release
Os01g0648000 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots.
Rice K+ uptake channel OsAKT1 is sensitive to salt stress.2005 · DOI: 10.1007/s00425-004-1437-9
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002643 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006813 potassium ion transport Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009860 pollen tube growth Biological Process
GO:0048767 root hair elongation Biological Process
GO:0090333 regulation of stomatal closure Biological Process
GO:1990573 potassium ion import across plasma membrane Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0034702 monoatomic ion channel complex Cellular Component
GO:0005242 inward rectifier potassium channel activity Molecular Function
GO:0005249 voltage-gated potassium channel activity Molecular Function
GO:0005267 potassium channel activity Molecular Function
KEGG gene cross-reference
ath:AT2G25600
ath:AT2G26650
ath:AT4G32500
dosa:Os01g0648000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.597
Rank 1 · LXL04_002643 · OH-1004
Cytoplasm0.173
Rank 2 · LXL04_002643 · OH-1004
Endoplasmic reticulum0.135
Rank 3 · LXL04_002643 · OH-1004
Lysosome / Vacuole0.103
Rank 4 · LXL04_002643 · OH-1004
Golgi apparatus0.083
Rank 5 · LXL04_002643 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans67-312 aa
PF07885.23Ion_trans_2212-305 aa
PF00027.36cNMP_binding405-490 aa
PF12796.14Ank_2535-619 aa
PF13637.13Ank_4541-584 aa
PF13857.13Ank_5550-601 aa
PF00023.37Ank563-594 aa
PF13606.13Ank_3563-591 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_002643PF00520.38Ion_trans673121e-42146.7
LXL04_002643PF07885.23Ion_trans_22123052.5e-1350.4
LXL04_002643PF00027.36cNMP_binding4054901.4e-1557.7
LXL04_002643PF12796.14Ank_25356195e-32111.0
LXL04_002643PF13637.13Ank_45415844.7e-2484.6
LXL04_002643PF13857.13Ank_55506018.7e-2587.2
LXL04_002643PF00023.37Ank5635943.8e-2587.3
LXL04_002643PF13606.13Ank_35635915.1e-1657.7
LXL04_002643PF12796.14Ank_26347145e-32111.0
LXL04_002643PF13637.13Ank_46346814.7e-2484.6
LXL04_002643PF13857.13Ank_56537018.7e-2587.2
LXL04_002643PF00023.37Ank6606913.8e-2587.3
LXL04_002643PF11834.14KHA8128752.8e-2176.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q38998Arabidopsis thalianaPotassium channel AKT166.782%Swiss-Protstrong database homology
Q8GXE6Arabidopsis thalianaPotassium channel AKT661.208%Swiss-Protstrong database homology
Q9SCX5Arabidopsis thalianaProbable potassium channel AKT559.604%Swiss-Protstrong database homology
P0C550Oryza sativa subsp. indicaPotassium channel AKT162.342%Swiss-Protstrong database homology
Q0JKV1Oryza sativa subsp. japonicaPotassium channel AKT162.227%Swiss-Protstrong database homology

JBrowse

View in Genome Browser