Gene Card
Gene overview
cDNA / CDS / Protein Sequences
945 bp · LXL04_002642|LXL04_002642|OH1004|cDNA
ATGAACGGAGAATTGGAGTTAGAAGCGAGGGATTTGGAAAACCCTAGCGATTCCGATCCTCTGCTTCCAAGTCACCAACACGTTGATTCTGATACACCGTCTTCGTCGCCATCGCCGGCCGCGGCGACTTCTATTGAAAGAGTAGGTGAAGATGTTGAAGAAGGTTCGATAGCCACCTGTCGTATCTGCCTTGAGTGCGACGGCGAAGAAGATGATGAACTGATATCTCCATGCATGTGCAAAGGCACCCAGCAGTTTGT...
945 bp · LXL04_002642|LXL04_002642|OH1004|CDS
ATGAACGGAGAATTGGAGTTAGAAGCGAGGGATTTGGAAAACCCTAGCGATTCCGATCCTCTGCTTCCAAGTCACCAACACGTTGATTCTGATACACCGTCTTCGTCGCCATCGCCGGCCGCGGCGACTTCTATTGAAAGAGTAGGTGAAGATGTTGAAGAAGGTTCGATAGCCACCTGTCGTATCTGCCTTGAGTGCGACGGCGAAGAAGATGATGAACTGATATCTCCATGCATGTGCAAAGGCACCCAGCAGTTTGT...
Protein
Download Protein FASTA314 aa · LXL04_002642|LXL04_002642|OH1004|PROTEIN
MNGELELEARDLENPSDSDPLLPSHQHVDSDTPSSSPSPAAATSIERVGEDVEEGSIATCRICLECDGEEDDELISPCMCKGTQQFVHRSCLDHWRSVKEGFAFSHCTTCKAQFHLLVVELEENSWRKIKFRLFVARDVCLVFLAVQTVIGIMGGLAYIADKDGSFRDSFNDSWDRILSRHPIPFYYCIGVLVFFVLLGFFGIILHCSSLNNDPRMAGCQNCCYGWGILDCFPASMEACFALVIVFVVIFAILGIAYGFL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002642 |
|---|---|
| TK1151 ID | TkA01G433720 |
| OH-1004 ID | LXL04_002642 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002642 |
|---|---|
| Location | Chr01:53620266-53621775 (+) |
| Description | Similar to Marchf8: E3 ubiquitin-protein ligase MARCHF8 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0002495 antigen processing and presentation of peptide antigen via MHC class II Biological Process GO:0006955 immune response Biological Process GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0045347 negative regulation of MHC class II biosynthetic process Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005764 lysosome Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005768 endosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component |
| KEGG gene cross-reference | hsa:55016 mmu:71779 mmu:72925 xla:495072 xtr:448095 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12906.14RINGv60-110 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002642 | PF12906.14 | RINGv | 60 | 110 | 8.8e-11 | 42.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.