LXL04_002558 | RubberDandelionOmics

Gene overview

LXL04_002558

Reference: OH-1004 Chr: Chr01 Coordinates: 51494662-51496209 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · LXL04_002558|LXL04_002558|OH1004|cDNA

ATGGCTCAAGCCGCAAGACTCAGTCTTCGAATGCAAAAAGAAGTCAAACTCCTCCTCACCGACCCACCTCCCGGTGCTTCTTTCCCTCACCTATCTCCTACATCCGATCTCTCTTCCTTCTCGCTCGCCGCCATCGATGCCCAGATCCAGGGCCCCGAAGATACAGTTTACGAAAAGGGGGTTTTTAAGATTAAGATCCAGATACCCGAAAGGTACCCGTTTCAACCCCCTATTGTGACGTTTGCCACTCCTATATACCA...

CDS

Download CDS FASTA

1131 bp · LXL04_002558|LXL04_002558|OH1004|CDS

ATGGCTCAAGCCGCAAGACTCAGTCTTCGAATGCAAAAAGAAGTCAAACTCCTCCTCACCGACCCACCTCCCGGTGCTTCTTTCCCTCACCTATCTCCTACATCCGATCTCTCTTCCTTCTCGCTCGCCGCCATCGATGCCCAGATCCAGGGCCCCGAAGATACAGTTTACGAAAAGGGGGTTTTTAAGATTAAGATCCAGATACCCGAAAGGTACCCGTTTCAACCCCCTATTGTGACGTTTGCCACTCCTATATACCA...

Protein

Download Protein FASTA

376 aa · LXL04_002558|LXL04_002558|OH1004|PROTEIN

MAQAARLSLRMQKEVKLLLTDPPPGASFPHLSPTSDLSSFSLAAIDAQIQGPEDTVYEKGVFKIKIQIPERYPFQPPIVTFATPIYHPNIDTGGRICLDILNLPPKGAWQPSLNISTVLTSIGLLLSEPNPDDGLMCEASKEYKYNKQVFDQKARSMTEKYAKSDASGSNMSQIDNEVPLNLSGESQIQEPKQDLKDLQFDQEQDNMQVAVNRSKKLCLSGKNLQHDSTKVTDLQKEKLLEIEKDSIDTTSFSKPKRKKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002558`
TK1151 ID	TkA01G471610
OH-1004 ID	LXL04_002558
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.800
Protein coverage (%)	TK1151 98.830 / OH-1004 47.872 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002558

Location Chr01:51494662-51496209 (-)

Description Similar to UBC37: Probable ubiquitin-conjugating enzyme E2 37

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24515`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002558 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0035519 protein K29-linked ubiquitination Biological Process

GO:0044314 protein K27-linked ubiquitination Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0070534 protein K63-linked ubiquitination Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

GO:0070979 protein K11-linked ubiquitination Biological Process

GO:0085020 protein K6-linked ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G24515

bta:505314

dre:768152

hsa:29089

mmu:67196

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.922

Rank 1 · LXL04_002558 · OH-1004

Cytoplasm0.163

Rank 2 · LXL04_002558 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_002558 · OH-1004

Mitochondrion0.025

Rank 4 · LXL04_002558 · OH-1004

Endoplasmic reticulum0.016

Rank 5 · LXL04_002558 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179.32UQ_con10-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002558	`PF00179.32`	UQ_con	10	156	3e-40	137.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q941B6`	Arabidopsis thaliana	Probable ubiquitin-conjugating enzyme E2 37	77.473%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card