LXL04_002535 | RubberDandelionOmics

Gene overview

LXL04_002535

Reference: OH-1004 Chr: Chr01 Coordinates: 50970727-50980292 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6825 bp · LXL04_002535|LXL04_002535|OH1004|cDNA

ATGCCATCCTCCGGAAGATCAGGTGGGCTGTTAAACTTATGGGACTCAACAATTTATAATGTCGAAGATGTAATTAAAGCAAAACATTTTTTGATTACCATTGGCACATGGGCGAACATTCCCGGTCATACAATAATTGCCAATGTATACGGACCGCATTCACCACAGGAGAAGAAAACGTTATGGGAAGAATTGATTCAAATTAAAAGTCAAAAAGCAGGAACATGGATTATATTGGGAGACTTCAACACAGTAAGAAC...

CDS

Download CDS FASTA

6825 bp · LXL04_002535|LXL04_002535|OH1004|CDS

ATGCCATCCTCCGGAAGATCAGGTGGGCTGTTAAACTTATGGGACTCAACAATTTATAATGTCGAAGATGTAATTAAAGCAAAACATTTTTTGATTACCATTGGCACATGGGCGAACATTCCCGGTCATACAATAATTGCCAATGTATACGGACCGCATTCACCACAGGAGAAGAAAACGTTATGGGAAGAATTGATTCAAATTAAAAGTCAAAAAGCAGGAACATGGATTATATTGGGAGACTTCAACACAGTAAGAAC...

Protein

Download Protein FASTA

2274 aa · LXL04_002535|LXL04_002535|OH1004|PROTEIN

MPSSGRSGGLLNLWDSTIYNVEDVIKAKHFLITIGTWANIPGHTIIANVYGPHSPQEKKTLWEELIQIKSQKAGTWIILGDFNTVRTREERYNSQFYSSTAFWFNRFIDRSGLIDIRMGGRRYTYFCQSDPKMSKLDRYLACPNFIHQFPTVSVIVLPRELSDHCPIVLQTGASDFGKPPFRFFNSWLKRDGFGPMVNGIWNNFRGYGAPDAYLAAKLRYLKTELKKWRASDFPKEEEELKKAKERLSDLDMAADQRVLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002535`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002535

Location Chr01:50970727-50980292 (+)

Description Similar to Transposon TX1 uncharacterized 149 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65750`	Putative ribonuclease H protein At1g65750.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002535 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003824 catalytic activity Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.585

Rank 1 · LXL04_002535 · OH-1004

Nucleus0.337

Rank 2 · LXL04_002535 · OH-1004

Cell membrane0.151

Rank 3 · LXL04_002535 · OH-1004

Endoplasmic reticulum0.038

Rank 4 · LXL04_002535 · OH-1004

Plastid0.032

Rank 5 · LXL04_002535 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078.33RVT_1443-564 aa

PF13966.12zf-RVT908-977 aa

PF00076.29RRM_11164-1232 aa

PF03372.30Exo_endo_phos1730-1874 aa

PF00078.33RVT_12176-2262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002535	`PF00078.33`	RVT_1	443	564	1.1e-26	94.7
LXL04_002535	`PF13966.12`	zf-RVT	908	977	2.3e-13	51.3
LXL04_002535	`PF00076.29`	RRM_1	1164	1232	5.6e-07	30.1
LXL04_002535	`PF03372.30`	Exo_endo_phos	1730	1874	1.1e-13	52.2
LXL04_002535	`PF00078.33`	RVT_1	2176	2262	1.1e-26	94.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C2F6`	Arabidopsis thaliana	Putative ribonuclease H protein At1g65750	26.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card