LXL04_002530 | RubberDandelionOmics

Gene overview

LXL04_002530

Reference: OH-1004 Chr: Chr01 Coordinates: 50876721-50879888 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2214 bp · LXL04_002530|LXL04_002530|OH1004|cDNA

ATGGCCTTCAGCTTCTCCACTTCAAAATCGCTACACTCCCATAACAAACTTCGTTCCTTCACTCTCTGTAAGTGTCCATCTACTCTTTCTTCCAGCTTCAACAATTCCTCACATAGCTTTCCCATCTTATCACCAAACAAACACTCAAAATTCTCACCTTTTCTTCTTCAAGCACACATCACCACGCATCAAGAAAACTCAAAACCCACAATTAGTCGTAGAATTATTGAAAAAATTCAACAGGGGTTTTCATCGTTCGA...

CDS

Download CDS FASTA

2214 bp · LXL04_002530|LXL04_002530|OH1004|CDS

ATGGCCTTCAGCTTCTCCACTTCAAAATCGCTACACTCCCATAACAAACTTCGTTCCTTCACTCTCTGTAAGTGTCCATCTACTCTTTCTTCCAGCTTCAACAATTCCTCACATAGCTTTCCCATCTTATCACCAAACAAACACTCAAAATTCTCACCTTTTCTTCTTCAAGCACACATCACCACGCATCAAGAAAACTCAAAACCCACAATTAGTCGTAGAATTATTGAAAAAATTCAACAGGGGTTTTCATCGTTCGA...

Protein

Download Protein FASTA

737 aa · LXL04_002530|LXL04_002530|OH1004|PROTEIN

MAFSFSTSKSLHSHNKLRSFTLCKCPSTLSSSFNNSSHSFPILSPNKHSKFSPFLLQAHITTHQENSKPTISRRIIEKIQQGFSSFESKDERVDKIPVKHEKRVVKENDKHTRNRAGSNRAKHKGSHEKISKNTAPEGGHLGTGKRFKTPKKGKFESPLLILRLGLEICSKLGDVMGAIAIFDLAKREGINLGQYHYAIILYLCSSASIGVVQPAKSGRSDTSSNNPELSNYSSQNFEGFQTLDELIHLIKDHEGAITRT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002530`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002530

Location Chr01:50876721-50879888 (+)

Description Similar to PRORP1: Proteinaceous RNase P 1, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32230`	Endonuclease RNase P responsible for the 5' maturation of tRNA precursors.	A single Arabidopsis organellar protein has RNase P activity.2010 · DOI: 10.1038/nsmb.1812 Mitochondrial ribonuclease P structure provides insight into the evolution of catalytic strategies for precursor-tRNA 5' processing.2012 · DOI: 10.1073/pnas.1209062109
`At4g21900`	Endonuclease RNase P responsible for the 5' maturation of tRNA precursors.	No verified direct reference in this release
`At2g16650`	Endonuclease RNase P responsible for the 5' maturation of tRNA precursors.	Nuclear Protein-Only Ribonuclease P2 Structure and Biochemical Characterization Provide Insight into the Conserved Properties of tRNA 5' End Processing Enzymes.2016 · DOI: 10.1016/j.jmb.2015.11.025

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002530 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001682 tRNA 5'-leader removal Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008033 tRNA processing Biological Process

GO:0043144 sno(s)RNA processing Biological Process

GO:0097745 mitochondrial tRNA 5'-end processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030678 mitochondrial ribonuclease P complex Cellular Component

GO:0042645 mitochondrial nucleoid Cellular Component

GO:0004526 ribonuclease P activity Molecular Function

KEGG gene cross-reference

ath:AT2G16650

ath:AT2G32230

ath:AT4G21900

hsa:9692

rno:299050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.867

Rank 1 · LXL04_002530 · OH-1004

Mitochondrion0.102

Rank 2 · LXL04_002530 · OH-1004

Nucleus0.075

Rank 3 · LXL04_002530 · OH-1004

Cytoplasm0.046

Rank 4 · LXL04_002530 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_002530 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17177.11PPR_long156-211 aa

PF17177.11PPR_long269-413 aa

PF23276.3TPR_24300-403 aa

PF16953.12PRORP455-681 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002530	`PF17177.11`	PPR_long	156	211	1.3e-65	221.5
LXL04_002530	`PF17177.11`	PPR_long	269	413	1.3e-65	221.5
LXL04_002530	`PF23276.3`	TPR_24	300	403	4e-08	34.0
LXL04_002530	`PF16953.12`	PRORP	455	681	1.3e-76	258.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GI4`	Arabidopsis thaliana	Proteinaceous RNase P 1, chloroplastic/mitochondrial	48.250%	Swiss-Prot	moderate database homology
`F4JKB6`	Arabidopsis thaliana	Proteinaceous RNase P 3	47.126%	Swiss-Prot	moderate database homology
`Q680B9`	Arabidopsis thaliana	Proteinaceous RNase P 2	45.759%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card