LXL04_002501 | RubberDandelionOmics

Gene overview

LXL04_002501

Reference: OH-1004 Chr: Chr01 Coordinates: 50190695-50192975 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1149 bp · LXL04_002501|LXL04_002501|OH1004|cDNA

AAAAGTTGAGGACTTCAGCcttaaaaaaaaaaccaattCGCTCTTCGAGGAGCAGGACTCAGGAAGACAGGAACGATCATTCTCCTTCGTCGATTGTTTCTAGGGTTCTCCATTGCAGTAGTATCAATGGAATCGACAACAGCAAACGATCCGATGATCGACACTAACAACGACGAAGAATCTACGCTGCTGACTATCCTCGACGCCTCCAGCTATCAGCTCCATGATCTCGACTCAATCGAGTTACCGCCGACCCTCAT...

CDS

Download CDS FASTA

1056 bp · LXL04_002501|LXL04_002501|OH1004|CDS

TTGTTTCTAGGGTTCTCCATTGCAGTAGTATCAATGGAATCGACAACAGCAAACGATCCGATGATCGACACTAACAACGACGAAGAATCTACGCTGCTGACTATCCTCGACGCCTCCAGCTATCAGCTCCATGATCTCGACTCAATCGAGTTACCGCCGACCCTCATCGAGATTGATTTGACGGCCAATCGATTGACTAAGTTGGATTCGCGTATTTCACATTTATCTAGTCTCAAAAAGCTCTCTCTTCGACAGAACCT...

Protein

Download Protein FASTA

351 aa · LXL04_002501|LXL04_002501|OH1004|PROTEIN

MFLGFSIAVVSMESTTANDPMIDTNNDEESTLLTILDASSYQLHDLDSIELPPTLIEIDLTANRLTKLDSRISHLSSLKKLSLRQNLFNDSGVEPISQWNTISGLEELVLRDNQLKKIPDVSIFKTLLVFDVSFNEITSMSGLSNASSTLKELYVSKNEVTKIEEIEHFHQLQILELGSNRLRVIENLQNLTKLQELWLGRNRIKSINLCGLKCIKKLSLQSNRLTSMKGLEECTALEEVYLSHNGITKMEGLSTLANLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002501`
TK1151 ID	TkA01G460870
OH-1004 ID	LXL04_002501
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 91.733 / OH-1004 98.006 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002501

Location Chr01:50190695-50192975 (+)

Description Similar to At5g19680: Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19680`	Inhibitor of protein-phosphatase 1 (PP1).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002501 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007059 chromosome segregation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0034504 protein localization to nucleus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0004864 protein phosphatase inhibitor activity Molecular Function

GO:0019888 protein phosphatase regulator activity Molecular Function

GO:0030234 enzyme regulator activity Molecular Function

KEGG gene cross-reference

ath:AT5G19680

ddi:DDB_G0284039

hsa:5510

mmu:66385

pon:100171414

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.586

Rank 1 · LXL04_002501 · OH-1004

Cytoplasm0.557

Rank 2 · LXL04_002501 · OH-1004

Mitochondrion0.043

Rank 3 · LXL04_002501 · OH-1004

Cell membrane0.030

Rank 4 · LXL04_002501 · OH-1004

Endoplasmic reticulum0.023

Rank 5 · LXL04_002501 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8104-159 aa

PF14580.13LRR_9143-227 aa

PF12799.14LRR_4149-182 aa

PF12799.14LRR_4171-208 aa

PF13855.13LRR_8171-225 aa

PF12799.14LRR_4216-254 aa

PF13855.13LRR_8236-291 aa

PF14580.13LRR_9239-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002501	`PF13855.13`	LRR_8	104	159	4.4e-23	81.5
LXL04_002501	`PF14580.13`	LRR_9	143	227	1.5e-13	51.4
LXL04_002501	`PF12799.14`	LRR_4	149	182	8e-37	125.2
LXL04_002501	`PF12799.14`	LRR_4	171	208	8e-37	125.2
LXL04_002501	`PF13855.13`	LRR_8	171	225	4.4e-23	81.5
LXL04_002501	`PF12799.14`	LRR_4	216	254	8e-37	125.2
LXL04_002501	`PF13855.13`	LRR_8	236	291	4.4e-23	81.5
LXL04_002501	`PF14580.13`	LRR_9	239	336	1.5e-13	51.4
LXL04_002501	`PF12799.14`	LRR_4	258	298	8e-37	125.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WJ9`	Arabidopsis thaliana	Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog	71.429%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card