LXL04_002405 | RubberDandelionOmics

Gene overview

LXL04_002405

Reference: OH-1004 Chr: Chr01 Coordinates: 47997926-47998156 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

231 bp · LXL04_002405|LXL04_002405|OH1004|cDNA

ATGAAGGAAACAGTTTGTTCGATTCTTCATACGGTGGGATTCCATGTCGCATCGCGTAATCAAGCCTTGCCGGAATCATTCGAGTGCCGAGGAAGTCCCCCGGAAACTTACATAGAGGAGTTCAGAAGCCGGACGCCGTCACTCCGTTACATCTCCCTCCGCCGCGCGATTAAACAGGAGTGTTTGGTTTGCTTAACAGAATTTCTTGCCCTCTATGTAGAAACCACATGA

CDS

Download CDS FASTA

231 bp · LXL04_002405|LXL04_002405|OH1004|CDS

ATGAAGGAAACAGTTTGTTCGATTCTTCATACGGTGGGATTCCATGTCGCATCGCGTAATCAAGCCTTGCCGGAATCATTCGAGTGCCGAGGAAGTCCCCCGGAAACTTACATAGAGGAGTTCAGAAGCCGGACGCCGTCACTCCGTTACATCTCCCTCCGCCGCGCGATTAAACAGGAGTGTTTGGTTTGCTTAACAGAATTTCTTGCCCTCTATGTAGAAACCACATGA

Protein

Download Protein FASTA

76 aa · LXL04_002405|LXL04_002405|OH1004|PROTEIN

MKETVCSILHTVGFHVASRNQALPESFECRGSPPETYIEEFRSRTPSLRYISLRRAIKQECLVCLTEFLALYVETT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002405`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002405

Location Chr01:47997926-47998156 (+)

Description Similar to XERICO: Probable E3 ubiquitin-protein ligase XERICO

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04240`	Function on abscisic acid homeostasis at post-translational level, probably through ubiquitin/proteasome-dependent substrate- specific degradation.	Upregulation of an Arabidopsis RING-H2 gene, XERICO, confers drought tolerance through increased abscisic acid biosynthesis.2006 · DOI: 10.1111/j.1365-313x.2006.02782.x Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054999

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002405 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009687 abscisic acid metabolic process Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT2G04240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.424

Rank 1 · LXL04_002405 · OH-1004

Nucleus0.367

Rank 2 · LXL04_002405 · OH-1004

Mitochondrion0.221

Rank 3 · LXL04_002405 · OH-1004

Cell membrane0.092

Rank 4 · LXL04_002405 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_002405 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SI09`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase XERICO	55.556%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card