LXL04_002365 | RubberDandelionOmics

Gene overview

LXL04_002365

Reference: OH-1004 Chr: Chr01 Coordinates: 46960442-46961371 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · LXL04_002365|LXL04_002365|OH1004|cDNA

ATGGTCCCTCCGTCACATTCCGTCCAAAATTGGACGTTAAGTCTGATGGTTGTATCCATGAAATGGGTTTTGAAATGGTGCAGTTCTGGGAATTCAGGAGGCGAGAGAAAGCTGATGCCCACCATTGAAGCCGAGCTTGGAAGAAGGTCGTTGTTGTACAGTCTTTTAATGCCGCTAAAACTCCCGGCGGTTTTTGCTGATGATTATGAAAACCCATCTCCCTCTGAGTCCAATAACAGTAAGTTTCAGACTTGGAATTC...

CDS

Download CDS FASTA

645 bp · LXL04_002365|LXL04_002365|OH1004|CDS

ATGGTCCCTCCGTCACATTCCGTCCAAAATTGGACGTTAAGTCTGATGGTTGTATCCATGAAATGGGTTTTGAAATGGTGCAGTTCTGGGAATTCAGGAGGCGAGAGAAAGCTGATGCCCACCATTGAAGCCGAGCTTGGAAGAAGGTCGTTGTTGTACAGTCTTTTAATGCCGCTAAAACTCCCGGCGGTTTTTGCTGATGATTATGAAAACCCATCTCCCTCTGAGTCCAATAACAGTAAGTTTCAGACTTGGAATTC...

Protein

Download Protein FASTA

214 aa · LXL04_002365|LXL04_002365|OH1004|PROTEIN

MVPPSHSVQNWTLSLMVVSMKWVLKWCSSGNSGGERKLMPTIEAELGRRSLLYSLLMPLKLPAVFADDYENPSPSESNNSKFQTWNSQYYRGEPIVVVAKENSQQATDSATVETPMFLPVRSLKNGVAESSMIDSKVNSFGRSNSRRFSKHLSKLSGAVSLEESEENIVLRSPIPWRSRSGRMEIKEDFTQTPEINPIDSPSSRFQSSNKWNTK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002365`
TK1151 ID	TkA06G173310
OH-1004 ID	LXL04_002365
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	95.000
Protein coverage (%)	TK1151 90.045 / OH-1004 92.991 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002365

Location Chr01:46960442-46961371 (-)

Description Similar to GH3.6: Indole-3-acetic acid-amido synthetase GH3.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54510`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	DFL1, an auxin-responsive GH3 gene homologue, negatively regulates shoot cell elongation and lateral root formation, and positively regulates the light response of hypocotyl length.2001 · DOI: 10.1046/j.1365-313x.2001.00957.x Characterization of an Arabidopsis enzyme family that conjugates amino acids to indole-3-acetic acid.2005 · DOI: 10.1105/tpc.104.026690
`At4g27260`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	Characterization of an Arabidopsis enzyme family that conjugates amino acids to indole-3-acetic acid.2005 · DOI: 10.1105/tpc.104.026690
`At4g37390`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	ydk1-D, an auxin-responsive GH3 mutant that is involved in hypocotyl and root elongation.2004 · DOI: 10.1046/j.1365-313x.2003.01973.x Characterization of an Arabidopsis enzyme family that conjugates amino acids to indole-3-acetic acid.2005 · DOI: 10.1105/tpc.104.026690

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0785400`	May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	No verified direct reference in this release
`Os05g0500900`	May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002365 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010120 camalexin biosynthetic process Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:1901183 positive regulation of camalexin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010279 indole-3-acetic acid amido synthetase activity Molecular Function

GO:0016881 acid-amino acid ligase activity Molecular Function

KEGG gene cross-reference

ath:AT4G27260

ath:AT4G37390

ath:AT5G54510

dosa:Os01g0785400

dosa:Os05g0500900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.383

Rank 1 · LXL04_002365 · OH-1004

Cytoplasm0.345

Rank 2 · LXL04_002365 · OH-1004

Cell membrane0.275

Rank 3 · LXL04_002365 · OH-1004

Endoplasmic reticulum0.092

Rank 4 · LXL04_002365 · OH-1004

Mitochondrion0.060

Rank 5 · LXL04_002365 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSQ4`	Arabidopsis thaliana	Indole-3-acetic acid-amido synthetase GH3.6	87.500%	Swiss-Prot	weak database homology
`O81829`	Arabidopsis thaliana	Indole-3-acetic acid-amido synthetase GH3.5	87.500%	Swiss-Prot	weak database homology
`Q9SZT9`	Arabidopsis thaliana	Indole-3-acetic acid-amido synthetase GH3.2	78.125%	Swiss-Prot	weak database homology
`Q8LQM5`	Oryza sativa subsp. japonica	Probable indole-3-acetic acid-amido synthetase GH3.1	81.250%	Swiss-Prot	weak database homology
`Q60EJ6`	Oryza sativa subsp. japonica	Probable indole-3-acetic acid-amido synthetase GH3.4	81.250%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card