LXL04_002337 | RubberDandelionOmics

Gene overview

LXL04_002337

Reference: OH-1004 Chr: Chr01 Coordinates: 46498388-46499051 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · LXL04_002337|LXL04_002337|OH1004|cDNA

ATGTCCACACAACAACAAATCATCGAACACGTCGTTCTCTTCAATGTCAAACCCGATGTTGAACCTACCAAAGTAGCCGCCATGATTGCTGGTCTCAAAGGGTTGGTTTCTCTCGACCTAGCAATCCATGTCAGCGCCGGAGAACTCTCTAAATCTCGATCGTGTAATTCCCTCACCTTCAGTCACATCCTCCATTGCCGTTTCAAATCAAACACCGATCTCCAGCCGATAATTGATGACATTATGGTTGTTGACTGGAT...

CDS

Download CDS FASTA

609 bp · LXL04_002337|LXL04_002337|OH1004|CDS

ATGTCCACACAACAACAAATCATCGAACACGTCGTTCTCTTCAATGTCAAACCCGATGTTGAACCTACCAAAGTAGCCGCCATGATTGCTGGTCTCAAAGGGTTGGTTTCTCTCGACCTAGCAATCCATGTCAGCGCCGGAGAACTCTCTAAATCTCGATCGTGTAATTCCCTCACCTTCAGTCACATCCTCCATTGCCGTTTCAAATCAAACACCGATCTCCAGCCGATAATTGATGACATTATGGTTGTTGACTGGAT...

Protein

Download Protein FASTA

202 aa · LXL04_002337|LXL04_002337|OH1004|PROTEIN

MSTQQQIIEHVVLFNVKPDVEPTKVAAMIAGLKGLVSLDLAIHVSAGELSKSRSCNSLTFSHILHCRFKSNTDLQPIIDDIMVVDWISDNNIINDSLKPGSVMRVTLLKLKADLVGNEKTKFFEMTEGLKNRFKAIEDVSYGENLPNDYSKGYSISSIGVFPRVAELEAFDLDVEMVKSLKEEVKGLVESEIVVDYVIPVAN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002337`
TK1151 ID	TkA01G454050
OH-1004 ID	LXL04_002337
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002337

Location Chr01:46498388-46499051 (-)

Description Similar to UP3: Stress-response A/B barrel domain-containing protein UP3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31670`	Involved in stress response.	No verified direct reference in this release
`At1g51360`	Involved in defense against fungal pathogens.	Functional characterization of pathogen-responsive protein AtDabb1 with an antifungal activity from Arabidopsis thaliana.2008 · DOI: 10.1016/j.bbapap.2008.06.023

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002337 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G51360

ath:AT2G31670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.792

Rank 1 · LXL04_002337 · OH-1004

Nucleus0.361

Rank 2 · LXL04_002337 · OH-1004

Peroxisome0.056

Rank 3 · LXL04_002337 · OH-1004

Mitochondrion0.040

Rank 4 · LXL04_002337 · OH-1004

Endoplasmic reticulum0.037

Rank 5 · LXL04_002337 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07876.19Dabb8-75 aa

PF07876.19Dabb103-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002337	`PF07876.19`	Dabb	8	75	5.9e-23	82.1
LXL04_002337	`PF07876.19`	Dabb	103	197	5.9e-23	82.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIP1`	Arabidopsis thaliana	Stress-response A/B barrel domain-containing protein UP3	39.070%	Swiss-Prot	moderate database homology
`Q9SYD8`	Arabidopsis thaliana	Stress-response A/B barrel domain-containing protein DABB1	33.019%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card