LXL04_002305 | RubberDandelionOmics

Gene overview

LXL04_002305

Reference: OH-1004 Chr: Chr01 Coordinates: 45817460-45819752 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1491 bp · LXL04_002305|LXL04_002305|OH1004|cDNA

ATGAAAGGAGTAGGAGGAGGCTACTTCTATGGGCTGAAGATGAATCAGCTCTCTCTCTTCTTCATCGTTTTTGTTTGTGCATCCATTGTAGTCTGGAATTGGGAGAAAACCCCTCGTCTTACAACTCTCCTTCCACCTCATGATCAATCGTTACATATTTTTCCAGAAGAATTGACAAGGGAACATATCACAGAAGTAAAAGACGATTTTAAGAAAGATGAACCCGTCATTAATACCCTCCCACCATCACTTTCAACAAA...

CDS

Download CDS FASTA

1491 bp · LXL04_002305|LXL04_002305|OH1004|CDS

ATGAAAGGAGTAGGAGGAGGCTACTTCTATGGGCTGAAGATGAATCAGCTCTCTCTCTTCTTCATCGTTTTTGTTTGTGCATCCATTGTAGTCTGGAATTGGGAGAAAACCCCTCGTCTTACAACTCTCCTTCCACCTCATGATCAATCGTTACATATTTTTCCAGAAGAATTGACAAGGGAACATATCACAGAAGTAAAAGACGATTTTAAGAAAGATGAACCCGTCATTAATACCCTCCCACCATCACTTTCAACAAA...

Protein

Download Protein FASTA

496 aa · LXL04_002305|LXL04_002305|OH1004|PROTEIN

MKGVGGGYFYGLKMNQLSLFFIVFVCASIVVWNWEKTPRLTTLLPPHDQSLHIFPEELTREHITEVKDDFKKDEPVINTLPPSLSTNTASFNTRQDETPTTQEIHHEKSDIIENSIPEENDGSKPFKPQLIASVTSHTTESAVSEQIDTPISNAENQVCNFGKGKWIPAENRPLYSGFGCKQWLSGMWACRLTQRTDFGYEKLKWQPKDCNIEDFTGPNFLKRMQHKTLAFVGDSLGRQQFQSLMCMVTGGEEMLDVEDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002305`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002305

Location Chr01:45817460-45819752 (-)

Description Similar to TBL16: Protein trichome birefringence-like 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20680`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g64020`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At2g37720`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g06230`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g06080`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002305 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G37720

ath:AT3G06080

ath:AT5G06230

ath:AT5G20680

ath:AT5G64020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.767

Rank 1 · LXL04_002305 · OH-1004

Endoplasmic reticulum0.080

Rank 2 · LXL04_002305 · OH-1004

Cell membrane0.067

Rank 3 · LXL04_002305 · OH-1004

Extracellular0.059

Rank 4 · LXL04_002305 · OH-1004

Cytoplasm0.046

Rank 5 · LXL04_002305 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416.12PMR5N158-211 aa

PF13839.13PC-Esterase214-494 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002305	`PF14416.12`	PMR5N	158	211	1.3e-13	51.7
LXL04_002305	`PF13839.13`	PC-Esterase	214	494	3e-70	238.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K5L5`	Arabidopsis thaliana	Protein trichome birefringence-like 16	53.042%	Swiss-Prot	strong database homology
`Q0WPS0`	Arabidopsis thaliana	Protein trichome birefringence-like 14	57.224%	Swiss-Prot	moderate database homology
`O80940`	Arabidopsis thaliana	Protein trichome birefringence-like 15	52.381%	Swiss-Prot	moderate database homology
`Q9FFZ4`	Arabidopsis thaliana	Protein trichome birefringence-like 9	32.345%	Swiss-Prot	moderate database homology
`Q9LDG2`	Arabidopsis thaliana	Protein trichome birefringence-like 10	32.113%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card