LXL04_002230 | RubberDandelionOmics

Gene overview

LXL04_002230

Reference: OH-1004 Chr: Chr01 Coordinates: 44355628-44357872 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · LXL04_002230|LXL04_002230|OH1004|cDNA

atgcCGACCGACATTGAAGATGAGATCAAGGACGAGAAGAATCCCCGCCCTCTCGATGAAGACGATATTGCTCTCCTCAAGACTTATGGATTGGGACCTTATTCTAACAGCATCAAGAAAGCTGAAAAGGATGTAAAGGAAATGGCCAAAAGGATTAATGATTTATGTGGTATCAAGGAGTCAGACACTGGCTTAGCCACACCTAGCCAATGGGATCTTGTTTCTGATAAACAAATGATGCAGGAAGAACAACCTCTTCA...

CDS

Download CDS FASTA

1281 bp · LXL04_002230|LXL04_002230|OH1004|CDS

ATGCCGACCGACATTGAAGATGAGATCAAGGACGAGAAGAATCCCCGCCCTCTCGATGAAGACGATATTGCTCTCCTCAAGACTTATGGATTGGGACCTTATTCTAACAGCATCAAGAAAGCTGAAAAGGATGTAAAGGAAATGGCCAAAAGGATTAATGATTTATGTGGTATCAAGGAGTCAGACACTGGCTTAGCCACACCTAGCCAATGGGATCTTGTTTCTGATAAACAAATGATGCAGGAAGAACAACCTCTTCA...

Protein

Download Protein FASTA

426 aa · LXL04_002230|LXL04_002230|OH1004|PROTEIN

MPTDIEDEIKDEKNPRPLDEDDIALLKTYGLGPYSNSIKKAEKDVKEMAKRINDLCGIKESDTGLATPSQWDLVSDKQMMQEEQPLQVARCTKIINPNTEDAQYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002230`
TK1151 ID	TkA01G440670
OH-1004 ID	LXL04_002230
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002230

Location Chr01:44355628-44357872 (+)

Description Similar to RPT1A: 26S proteasome regulatory subunit 7 homolog A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53750`	The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0192600`	The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release
`Os02g0784700`	The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002230 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008540 proteasome regulatory particle, base subcomplex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0036402 proteasome-activating activity Molecular Function

KEGG gene cross-reference

ath:AT1G53750

dosa:Os06g0192600

pper:18783658

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · LXL04_002230 · OH-1004

Nucleus0.499

Rank 2 · LXL04_002230 · OH-1004

Cell membrane0.085

Rank 3 · LXL04_002230 · OH-1004

Endoplasmic reticulum0.049

Rank 4 · LXL04_002230 · OH-1004

Mitochondrion0.048

Rank 5 · LXL04_002230 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21236.4OB_PRS779-147 aa

PF00004.36AAA205-338 aa

PF17862.8AAA_lid_3360-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002230	`PF21236.4`	OB_PRS7	79	147	1.7e-39	133.9
LXL04_002230	`PF00004.36`	AAA	205	338	2.4e-41	142.0
LXL04_002230	`PF17862.8`	AAA_lid_3	360	403	1e-12	48.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSB5`	Arabidopsis thaliana	26S proteasome regulatory subunit 7 homolog A	95.540%	Swiss-Prot	strong database homology
`P0DKK0`	Oryza sativa subsp. japonica	26S proteasome regulatory subunit 7B	94.836%	Swiss-Prot	strong database homology
`P0DKJ9`	Oryza sativa subsp. japonica	26S proteasome regulatory subunit 7A	94.836%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card