LXL04_002226 | RubberDandelionOmics

Gene overview

LXL04_002226

Reference: OH-1004 Chr: Chr01 Coordinates: 44187105-44189332 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1858 bp · LXL04_002226|LXL04_002226|OH1004|cDNA

GTATAACAAAAACAGAAGCACCATAGAAGCCGGTTTTCCATCTCCCTCTCACTCTCTTATATATACATAACCTAACTTTATTTATTACACTCATTCCCATCTCATCTCTTTCTATTTTCATTAGATATTATTTATGGATACCATTAAATCTTTCAAGGGCTACGGGAAGGTAGATCCCGTCGAAGAACAAGCATTTCGCCAGAAAACCCGTAAGCGTCTCATCATCCTCATCGTCTCCGTAGTCCTACTCCTTGCTGTCA...

CDS

Download CDS FASTA

1725 bp · LXL04_002226|LXL04_002226|OH1004|CDS

ATGGATACCATTAAATCTTTCAAGGGCTACGGGAAGGTAGATCCCGTCGAAGAACAAGCATTTCGCCAGAAAACCCGTAAGCGTCTCATCATCCTCATCGTCTCCGTAGTCCTACTCCTTGCTGTCATAATCGGAGCCGTCGCCCGCACCGTCATTCACAACCGCAACAACGATGATGGTAAAGATGCTCCTTCCGCTCAGCTTTCCTCTGCCCAATCCATCAAGGCCGTCTGTAGCCAGACTCTGTATCCTGAATCTTG...

Protein

Download Protein FASTA

574 aa · LXL04_002226|LXL04_002226|OH1004|PROTEIN

MDTIKSFKGYGKVDPVEEQAFRQKTRKRLIILIVSVVLLLAVIIGAVARTVIHNRNNDDGKDAPSAQLSSAQSIKAVCSQTLYPESCYSSISELDKSNTTDPEDLLKLSLQVVFNSLSGLSSLPGELIKATSDDAAKEALRVCETVLDDAVDYLRDSISSMEVKSGQKLLSVTKIDDLKTWLSTALTHQDTCLDALEEMNSTVLADVKSKMQNSTEYASNSLAIVSKISGILGKFNLPIHRKLLGEFPEWVNPGVRRLLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002226`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002226

Location Chr01:44187105-44189332 (-)

Description Similar to MPE3: Pectinesterase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53840`	Acts in the modification of cell walls via demethylesterification of cell wall pectin (By similarity).	Methylation of protein phosphatase 2A-Influence of regulators and environmental stress factors.2017 · DOI: 10.1111/pce.13038
`At3g14300`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g04960`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At3g10710`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002226 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G53840

ath:AT3G14300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.402

Rank 1 · LXL04_002226 · OH-1004

Extracellular0.317

Rank 2 · LXL04_002226 · OH-1004

Cytoplasm0.116

Rank 3 · LXL04_002226 · OH-1004

Lysosome / Vacuole0.109

Rank 4 · LXL04_002226 · OH-1004

Endoplasmic reticulum0.098

Rank 5 · LXL04_002226 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043.21PMEI73-224 aa

PF01095.26Pectinesterase267-559 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002226	`PF04043.21`	PMEI	73	224	2.8e-32	112.7
LXL04_002226	`PF01095.26`	Pectinesterase	267	559	8.1e-135	449.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q43867`	Arabidopsis thaliana	Pectinesterase 1	59.044%	Swiss-Prot	strong database homology
`Q9LUL8`	Arabidopsis thaliana	Putative pectinesterase/pectinesterase inhibitor 26	54.851%	Swiss-Prot	strong database homology
`Q9FF78`	Arabidopsis thaliana	Probable pectinesterase/pectinesterase inhibitor 46	45.955%	Swiss-Prot	moderate database homology
`Q9SG77`	Arabidopsis thaliana	Putative pectinesterase/pectinesterase inhibitor 24	44.578%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card